DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr20

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:228 Identity:54/228 - (23%)
Similarity:92/228 - (40%) Gaps:33/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FQPEF-----VESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTK----------AIQAIHEN 89
            :.|.|     :...:|::|..|......|.:..|....|.|::.:|:          .:..:..:
  Fly   263 YGPHFEDVQRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMH 327

  Fly    90 VITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMK-SQIGFLDVVIPPDFISE---D 150
            ..|.:.|..:.....|.|.|.|..|.::|...|.||::|.|.: .||. |.|..|...|.:   |
  Fly   328 TYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQIN-LHVNAPKVMIVDEVGD 391

  Fly   151 TSSDVIVPEGSSVRLTCRAR--GYPEPIVTWRREDG--NEIVLKDNVGTKT-LAPSFRGEVLKLS 210
            ...:......|:::|:|..|  .....:|.|:..|.  |..|.:..|..|| |........|.::
  Fly   392 PLQEKYYEIDSTLQLSCVVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIA 456

  Fly   211 KISRNEMGSYLCIASNGVPPSVSKRISLSIHFH 243
            |||:.:.|:|.|        |:|:..:.:|..|
  Fly   457 KISKTDSGNYTC--------SISEFQNFTIVVH 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 19/89 (21%)
Ig 51..131 CDD:299845 19/89 (21%)
I-set 144..240 CDD:254352 24/103 (23%)
IGc2 159..228 CDD:197706 20/73 (27%)
Ig 244..337 CDD:299845 54/228 (24%)
I-set 244..337 CDD:254352 54/228 (24%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 19/86 (22%)
Ig 279..378 CDD:299845 23/99 (23%)
Ig 400..471 CDD:299845 21/78 (27%)
IG_like 402..480 CDD:214653 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.