DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and robo1

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_476899.1 Gene:robo1 / 37603 FlyBaseID:FBgn0005631 Length:1395 Species:Drosophila melanogaster


Alignment Length:331 Identity:80/331 - (24%)
Similarity:132/331 - (39%) Gaps:60/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGG---YRVGWLKADTKAIQAIHENVITH 93
            |..:.|...:|.|::...:..:..|:.|||.|.|   ||   .:|.|.|.:             .
  Fly   245 SYAKLIVQVKPYFMKEPKDQVMLYGQTATFHCSV---GGDPPPKVLWKKEE-------------G 293

  Fly    94 NPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQL--NTDPMKSQIGFLDVVIPPDFISEDTSSDVI 156
            |..|:.:.:..:..:|.|..::..|.|.|:|:.  |...:.::...: |..||:|....::..|.
  Fly   294 NIPVSRARILHDEKSLEISNITPTDEGTYVCEAHNNVGQISARASLI-VHAPPNFTKRPSNKKVG 357

  Fly   157 VPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGE-------VLKLSKISR 214
            :  ...|:|.|.|.|.|.|.|.|         .|:.|.|.....|..|.       .|:::.:.:
  Fly   358 L--NGVVQLPCMASGNPPPSVFW---------TKEGVSTLMFPNSSHGRQHVAADGTLQITDVRQ 411

  Fly   215 NEMGSYLCIASNGVPPSVSKRISLSIHF-----HPVIQV--PNQLVGAPLGTDVQIECHVEASPK 272
            .:.|.|:|.|.: |..|.:.|:.|.:..     .|:||:  .||.:  |.|:...:.|....:|.
  Fly   412 EDEGYYVCSAFS-VVDSSTVRVFLQVSSLDERPPPIIQIGPANQTL--PKGSVATLPCRATGNPS 473

  Fly   273 SINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRL 337
            ....|..| |..:....:|.:.:.|        |:.|...|..|.|:|.|.|....||...:..|
  Fly   474 PRIKWFHD-GHAVQAGNRYSIIQGS--------SLRVDDLQLSDSGTYTCTASGERGETSWAATL 529

  Fly   338 -YEIPG 342
             .|.||
  Fly   530 TVEKPG 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 20/84 (24%)
Ig 51..131 CDD:299845 20/84 (24%)
I-set 144..240 CDD:254352 26/102 (25%)
IGc2 159..228 CDD:197706 19/75 (25%)
Ig 244..337 CDD:299845 24/94 (26%)
I-set 244..337 CDD:254352 24/94 (26%)
robo1NP_476899.1 Ig 56..151 CDD:299845
I-set 56..150 CDD:254352
I-set 157..251 CDD:254352 1/5 (20%)
Ig2_Robo 159..251 CDD:143201 1/5 (20%)
I-set 255..341 CDD:254352 22/102 (22%)
Ig3_Robo 272..341 CDD:143202 19/85 (22%)
IG_like 351..436 CDD:214653 24/96 (25%)
Ig 362..444 CDD:299845 23/91 (25%)
I-set 445..531 CDD:254352 25/96 (26%)
IGc2 459..521 CDD:197706 16/70 (23%)
FN3 549..637 CDD:238020
FN3 673..762 CDD:238020
fn3 770..855 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.