DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and babos

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:182 Identity:43/182 - (23%)
Similarity:66/182 - (36%) Gaps:62/182 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 LNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPI----------VTWR 180
            ::.|.|::...|       |:..||.|:.  .|:..|          |.|:          ||..
  Fly    29 MDDDQMQADDDF-------DYGGEDQSAP--SPQTKS----------PNPVASEKINKTLSVTGI 74

  Fly   181 REDGNEIVLK-------------------DNV---GTKTLAPSFRGEV---LKLSKISRNEMGSY 220
            |  |.::|||                   |||   |...:.|:|:.:.   |.:.|.|....|||
  Fly    75 R--GEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKLDANYDLTILKASPQVAGSY 137

  Fly   221 LC--IASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEAS 270
            ||  :.|..|   |:.:::::.|....| .|.....|.......:.|.|.||
  Fly   138 LCKVLPSGSV---VNTKVTIAEHSLDAI-APESSTSAAGSASSFLGCTVLAS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 0/2 (0%)
Ig 51..131 CDD:299845 1/4 (25%)
I-set 144..240 CDD:254352 32/132 (24%)
IGc2 159..228 CDD:197706 25/105 (24%)
Ig 244..337 CDD:299845 7/27 (26%)
I-set 244..337 CDD:254352 7/27 (26%)
babosNP_001286719.1 ig 70..154 CDD:278476 24/88 (27%)
IG_like 70..154 CDD:214653 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.