DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and CG13506

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:445 Identity:89/445 - (20%)
Similarity:156/445 - (35%) Gaps:139/445 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PEFVESISNVSVAVGRDATFTCHVRHLG-GYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQN 105
            |.|..:...|....|.|....|..|:.. ...|.|.|  .:.|.|..:|.|:...:..:::    
  Fly    70 PYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYK--NRIIIANGQNPISQRVQCMLNN---- 128

  Fly   106 TWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRAR 170
              ::.::.||.||...|.|:                |.|..:.:.|:..|    |:.:.:.|..|
  Fly   129 --SILLRNVSPEDSDDYYCE----------------ILPQRVRQHTALRV----GARLSILCDDR 171

  Fly   171 GYPEPIVTWRREDGNEI----VLKDNVGTKTLAPSFRGE---------VLKLSKISRNEMGSYLC 222
            ...:...|:|:.|.:::    .|.||...|.......|:         |:.|..:.....|.|.|
  Fly   172 DITDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQC 236

  Fly   223 IASNGV--PPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMI 285
            :|.:|.  ||..:  :.:.:.:.|::......|....|...::.|:..|.|...:|:||| |:.:
  Fly   237 LADDGSRHPPHGT--VHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKD-GKTL 298

  Fly   286 VTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPL 350
            ..|.||.:::|..:.: .:.::|||:....|:|.|.|..:|::|                     
  Fly   299 QLSDKYSLKDSVHNDH-NRTTLIVREVTDSDLGEYLCQVENAIG--------------------- 341

  Fly   351 NGGGKGGGAGGSLDADANDILKQKQQVKVTYQPEDEELQYGSVEDFEAEGGEGGGLTPLSPHVYY 415
                            :|::     :|.|:|.||..:.:..:||                     
  Fly   342 ----------------SNEV-----KVHVSYNPETPQFEDMTVE--------------------- 364

  Fly   416 TSGNKPATHKPGNSGGNQHLHQ--------------------QHHHHHHHNNNNN 450
              |||...|....|      ||                    |....|.|||.:|
  Fly   365 --GNKVTLHWLVRS------HQLLSEAMLDYQLTGSYTWSTVQVLETHRHNNTDN 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 18/80 (23%)
Ig strand B 59..63 CDD:409353 0/3 (0%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 0/7 (0%)
Ig 152..240 CDD:472250 21/102 (21%)
Ig strand B 163..167 CDD:409275 0/3 (0%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/12 (8%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 24/92 (26%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 1/3 (33%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 19/83 (23%)
Ig_3 173..238 CDD:464046 13/64 (20%)
Ig 258..349 CDD:472250 26/134 (19%)
Ig strand B 275..279 CDD:409353 0/3 (0%)
Ig strand C 288..292 CDD:409353 1/3 (33%)
Ig strand E 317..321 CDD:409353 0/3 (0%)
Ig strand F 331..336 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.