DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and wrapper

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:318 Identity:82/318 - (25%)
Similarity:135/318 - (42%) Gaps:46/318 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNT 106
            |..|::..|.:|.:  ..|.....|:     |.|.:.|...:.:.|.. :....|:.:       
  Fly    41 PTTVKTYENDTVQL--PCTLNTPFRY-----VRWHRDDVALVDSRHPE-LPPPDRIML------- 90

  Fly   107 W---NLHIKAVSEEDRGGYMCQLNTDP-MKSQIGFLDVVIPPDFISEDTSSDVIVPE-GSSVRLT 166
            |   :|.:..|...|.|.|.|::|:|. ...|...::|.:.|..:.|  .||:.... |:...:.
  Fly    91 WPNGSLQVANVQSSDTGDYYCEMNSDSGHVVQQHAIEVQLAPQVLIE--PSDLTEQRIGAIFEVV 153

  Fly   167 CRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPS 231
            |.|:|.|:|::|||. :||.|..:.|.|.:        :.|.|...|||:.|...|:|||||...
  Fly   154 CEAQGVPQPVITWRL-NGNVIQPQSNTGNR--------QSLILEIKSRNQAGLIECVASNGVGEP 209

  Fly   232 VSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQES 296
            ....:.|.:.|.|.:.:|..:|...||:...:||.|||:|.:...|...  .:.|..|.:.....
  Fly   210 AVANVYLHVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHH--GLPVALGAHSTTHE 272

  Fly   297 SQSMYETKMS-----------MIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGP 343
            |:  .:|..|           ::|:..:..|:|.|.|.|.|.:.....|:.|...|.|
  Fly   273 SE--LQTNRSVDHYVNAVRHMLVVKSVRNADMGQYECRASNQISVKSGSVELTGRPMP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 17/82 (21%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 2/10 (20%)
Ig 152..240 CDD:472250 29/88 (33%)
Ig strand B 163..167 CDD:409275 0/3 (0%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 1/4 (25%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 25/103 (24%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 1/14 (7%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
wrapperNP_477404.1 IG_like 41..118 CDD:214653 20/91 (22%)
Ig strand B 52..56 CDD:409353 1/5 (20%)
Ig strand C 64..68 CDD:409353 1/8 (13%)
Ig strand E 94..98 CDD:409353 1/3 (33%)
Ig strand F 108..113 CDD:409353 2/4 (50%)
Ig strand G 122..125 CDD:409353 1/2 (50%)
Ig 133..219 CDD:472250 30/96 (31%)
Ig strand B 150..154 CDD:409353 0/3 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 1/4 (25%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 222..311 CDD:464046 23/92 (25%)
FN3 339..431 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.