DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Lac

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:323 Identity:97/323 - (30%)
Similarity:162/323 - (50%) Gaps:20/323 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLLIVSLLEAIGAFQPEFVESISNVSVA-VGRDATFTCHVRHLGGYRVGWLKADTKAI-QAIHEN 89
            |||.:.:.:.:....|. :..|:...:. :|....|.|.|::...|.|.:||.|:..: .:....
  Fly    14 LLLAIFVQQTLAQRTPT-ISYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGST 77

  Fly    90 VITHNPRVTVSHLDQN--TWNLHIKAVSEEDRGGYMCQ--LNTDPMKSQIGFLDVVIPPDFISED 150
            ::..:.|.::.: |.|  |:.|.||.:.|.|.|.|.||  ::|....|....|.|..|| .||::
  Fly    78 LVIKDSRFSLRY-DPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPP-VISDN 140

  Fly   151 TSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRN 215
            ::..|:..|||.|::.|.|.|||.|.:|||||: |.|:..|:.       ::.|..|::..:.:.
  Fly   141 STQSVVASEGSEVQMECYASGYPTPTITWRREN-NAILPTDSA-------TYVGNTLRIKSVKKE 197

  Fly   216 EMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKD 280
            :.|:|.|:|.|||.....:.|::.:.|.|||.||...:|..|..|:.:|||:||.|.....|.||
  Fly   198 DRGTYYCVADNGVSKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKD 262

  Fly   281 TGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYE--IP 341
            ..: :..:..|.:...:.:...|..::.|...:|...|.|.|.|.|..||.::.:.|:|  ||
  Fly   263 DIQ-LANNQHYSISHFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNLFETIIP 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 22/85 (26%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 4/9 (44%)
Ig 152..240 CDD:472250 29/87 (33%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 28/92 (30%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
LacNP_523713.2 IG_like 36..131 CDD:214653 25/95 (26%)
Ig strand B 46..50 CDD:409381 1/3 (33%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 1/3 (33%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 29/82 (35%)
Ig 227..318 CDD:472250 27/91 (30%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 0/3 (0%)
Ig strand F 300..305 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.