DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Sdk2

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:461 Identity:107/461 - (23%)
Similarity:172/461 - (37%) Gaps:86/461 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DRNG--KMLIHLLLIVSLLEAIGA----FQPEFVESISNVSVAVG-RDATFTC--HVRHLGGYRV 73
            |:||  |....:.|.|   |.:|.    ..|..:....|.||..| .:.|..|  :.|.|....:
  Rat   191 DKNGDNKTSQPITLAV---ENVGGPADPIAPTIIIPPKNTSVVAGTSEVTMECVANARPLIKLHI 252

  Fly    74 GWLKADTKAIQAIHENVIT-HNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQL-----NTDPMK 132
            .|.|..     |:..|.|: :|.|:|:::          ..||  |.|.|.|:.     :..|: 
  Rat   253 VWKKDG-----ALLSNGISDYNRRLTITN----------PMVS--DAGYYECEAMLRSSSVAPV- 299

  Fly   133 SQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKT 197
            ::..:|.|:.||.|:.| ....:.......|.:.|||:|.|.|.:||.::..  :|   .||..|
  Rat   300 TRGAYLSVLEPPQFVRE-PERHITAEMEKVVDIPCRAKGVPPPSITWYKDAA--LV---EVGKLT 358

  Fly   198 LAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPL----- 257
            .........|::|.:..::.|...|.|.|....:.:..      :..|..:...:...||     
  Rat   359 RFKQRSDGGLQISGLLPDDTGMVQCFAHNAAGEAQTST------YLAVTSIAPNITRGPLDSTVI 417

  Fly   258 -GTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYR 321
             |..|.:.|....:|:....|.|  ||.|:.||.  ||....::.|:. |:::......|.|:|.
  Rat   418 DGMSVVLACETSGAPRPAITWQK--GERILASGS--VQLPRFTLLESG-SLLISPTHISDAGTYT 477

  Fly   322 CIAKNSLGEVDSSIRLY-----EIPGPNRNKNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTY 381
            |:|.||.|..::|..|.     .|..|.::::.:.|.......|.:.|          .:|.|.|
  Rat   478 CLATNSRGVDEASADLVVWARTRITKPPQDQSVIKGTQASMVCGVTHD----------PRVTVRY 532

  Fly   382 QPEDEELQYGSVEDFEAEGGEGGGLTPLSPHVYYTSGNKPATH------KPGNSGGNQHLH-QQH 439
            ..|.:........:........|.|     |:..|......|:      ..||...|.||. :|.
  Rat   533 VWEKDGATLAVETNPRIRLDRNGSL-----HISQTWSGDIGTYTCRVLSAGGNDSRNAHLRVRQL 592

  Fly   440 HHHHHH 445
            .|...|
  Rat   593 PHAPEH 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 22/88 (25%)
Ig 51..131 CDD:299845 21/88 (24%)
I-set 144..240 CDD:254352 22/95 (23%)
IGc2 159..228 CDD:197706 19/68 (28%)
Ig 244..337 CDD:299845 27/98 (28%)
I-set 244..337 CDD:254352 27/98 (28%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653 5/14 (36%)
Ig 135..191 CDD:299845 107/461 (23%)
IG_like 225..307 CDD:214653 24/99 (24%)
IGc2 236..289 CDD:197706 18/69 (26%)
I-set 311..400 CDD:254352 22/100 (22%)
Ig 329..397 CDD:143165 19/78 (24%)
I-set 405..495 CDD:254352 27/94 (29%)
Ig 419..495 CDD:299845 25/80 (31%)
Ig 505..589 CDD:299845 17/98 (17%)
IG_like 505..589 CDD:214653 17/98 (17%)
FN3 593..684 CDD:238020 2/6 (33%)
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.