DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr19

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:362 Identity:82/362 - (22%)
Similarity:146/362 - (40%) Gaps:73/362 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLLIVSLLEAIG-----------AFQPEF-VESISNVSVAVGRDATFTCHVRHLGGYRVGWLKAD 79
            |||:.|....:|           ..|.:| .::.:.|....|..|...|.|:......|.|::  
  Fly    14 LLLLSSTFSDVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVKVNSPATVSWIR-- 76

  Fly    80 TKAIQAIHENVITH--NPRVTVSHL-DQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVV 141
            .|..|.:...:.||  :.|..|.|. ....|:|.||||.|||||.|.|||:..|.:|.:..|.:|
  Fly    77 RKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQSIVIELKIV 141

  Fly   142 IPPDFISEDTSS-DVIVPEGSSVRLTCRARGYPE--PIVTWRREDGNEIVLKDNVGTKTLAPSFR 203
               :.::|.:|: ::.:.|.|::||.|:.:...|  ..|.|..:  ::::..|:.|         
  Fly   142 ---EAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFWYHD--SKMINYDSQG--------- 192

  Fly   204 GEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVE 268
            |.|:.....|..:.|.:...:     |:...|.::.      ::..|.::.:.||:...|:....
  Fly   193 GFVVTSIGQSNPQSGQFYRSS-----PANKSRATMP------MESSNGVLNSLLGSSDAIKAPAA 246

  Fly   269 ASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMS---MIVRKFQKDDVGSYRCIAKNSLGE 330
            ..|.|..|                :.:..||.|....|   :.|::......|:|.|...|:.  
  Fly   247 NVPSSTPY----------------MTQQHQSAYLLNPSVSVLTVKQVNFRHAGNYTCAPSNAR-- 293

  Fly   331 VDSSIRLYEIPG------PNRNKNPLNGGGKGGGAGG 361
             .:||.::.:.|      .:.|::.|:....|.|..|
  Fly   294 -PASITVHVLRGEKTAAMQHANRSILDTETNGNGTFG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 29/82 (35%)
Ig 51..131 CDD:299845 29/82 (35%)
I-set 144..240 CDD:254352 18/98 (18%)
IGc2 159..228 CDD:197706 14/70 (20%)
Ig 244..337 CDD:299845 18/95 (19%)
I-set 244..337 CDD:254352 18/95 (19%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 28/78 (36%)
IGc2 55..125 CDD:197706 25/71 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.