DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and DIP-theta

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:500 Identity:176/500 - (35%)
Similarity:260/500 - (52%) Gaps:93/500 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNT 106
            |:|.|.:.||:|.|.|:|...|.|.:|..|::.||:.||:.|..|..:|||.|.|::::|.::..
  Fly   130 PKFGELLQNVTVPVSREAVLQCVVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITHAEKRA 194

  Fly   107 WNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARG 171
            |.|.|:.|.|.|:|.||||:||||||||:|:||||:|||.:...||:|:::.|||:|.|.|.|.|
  Fly   195 WILRIRDVKESDKGWYMCQINTDPMKSQVGYLDVVVPPDILDYPTSTDMVIREGSNVTLKCAATG 259

  Fly   172 YPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRI 236
            .|.|.:|||||.|..|.|.:  |.:.:|  :.|..|.::|::|..||:||||||||:||:||||:
  Fly   260 SPTPTITWRREGGELIPLPN--GAEAVA--YNGSFLTIAKVNRLNMGAYLCIASNGIPPTVSKRV 320

  Fly   237 SLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMY 301
            .|.:||.|:|.:.||||||.|..::.:||..||.|||||||:|:  :.|:..|:..|.|:.:|.|
  Fly   321 MLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWMKN--DTIIVPGERFVPETFESGY 383

  Fly   302 ETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIP------------------------- 341
            :..|.:.:.:....|.|:|||:||||||:.|.:|:||.||                         
  Fly   384 KITMRLTIYEVDIQDFGAYRCVAKNSLGDTDGAIKLYHIPQTTTMTTMAPTVSINTVPVVLVKYN 448

  Fly   342 -------GPNRNKNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTYQP----EDEELQYGSVED 395
                   ..|.|.||.|                             :.|    ::.:||.|....
  Fly   449 KEQRYGSSQNSNTNPYN-----------------------------FNPGNSQQNTKLQRGKSNS 484

  Fly   396 FEAEGGEGG------GLTP--LSPHVYYTSGNKPATHKPGNSGGNQHLHQQHHHHHHHNNNNNNQ 452
            ..::....|      |.|.  .:...:::|.:..::   .:|.|..|..||||.....|:.:::.
  Fly   485 KGSDQSPSGLNNVFVGATSSLWNSQDHHSSSSSSSS---ASSRGRDHHQQQHHQQQQQNHGSDHG 546

  Fly   453 QHSGGPGGGP--TGGDAGSLGGEM-------GGITRKPP--PYYG 486
            ......|..|  |..||.||..::       |..:|..|  |..|
  Fly   547 ASYRSDGKSPHLTNHDAKSLTDDLDRMQDLKGWASRLSPISPILG 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 34/79 (43%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 0/3 (0%)
Ig strand E 103..111 CDD:409353 2/7 (29%)
Ig 152..240 CDD:472250 43/87 (49%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 3/4 (75%)
Ig strand G 233..236 CDD:409275 2/2 (100%)
Ig 244..337 CDD:472250 41/92 (45%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 3/3 (100%)
Ig strand E 305..309 CDD:409353 1/3 (33%)
Ig strand F 319..324 CDD:409353 3/4 (75%)
Ig strand G 332..335 CDD:409353 1/2 (50%)
DIP-thetaNP_723103.1 IG_like 137..230 CDD:214653 45/92 (49%)
Ig strand B 147..151 CDD:409353 1/3 (33%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 195..199 CDD:409353 2/3 (67%)
Ig strand F 209..214 CDD:409353 3/4 (75%)
Ig strand G 221..224 CDD:409353 2/2 (100%)
Ig 232..324 CDD:472250 46/95 (48%)
Ig strand B 251..255 CDD:409275 2/3 (67%)
Ig strand C 264..268 CDD:409275 1/3 (33%)
Ig strand E 289..293 CDD:409275 1/3 (33%)
Ig strand F 303..308 CDD:409275 3/4 (75%)
Ig strand G 317..320 CDD:409275 2/2 (100%)
Ig_3 327..408 CDD:464046 34/82 (41%)

Return to query results.
Submit another query.