DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and bdl

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:362 Identity:88/362 - (24%)
Similarity:139/362 - (38%) Gaps:70/362 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPVSAKRLLRNFQFTSCDRNGKMLIHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHV 65
            ||....|..|        ::|..|:.||.|:.|:..............:|:...||....|.|::
  Fly     1 MPAKRSRTFR--------QSGSALLALLAIILLMNISCTSAARDHRRQTNLEAKVGSHVVFNCYI 57

  Fly    66 RHLGG----YRVGWLKADTKAIQAIHENVIT----HNPRVTVSHLDQN-----TWNLHIKAVSEE 117
            .....    |.|.|.| |.|.|...:|...:    .|.|:   ||.:|     ..::::.|:.|.
  Fly    58 DFPFDAPIPYLVHWTK-DNKKIFTWYEQETSTSELFNGRL---HLVENHPEFGRASVNLTAIRES 118

  Fly   118 DRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRL-----TCR--------- 168
            |:|.|.||::. |.:|          |...:..|:..:.|..||.:|:     |.|         
  Fly   119 DQGWYHCQVSF-PNRS----------PSVRNNGTAYHLAVQGGSLIRIPPVNQTIREGQTAFFHC 172

  Fly   169 ARGYPE-PIVTWRREDG---NEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVP 229
            ...:|| ...:|.: ||   .|:  :|.|....:.|.  |. |.:.....:::|.|.|...|...
  Fly   173 VMKHPENSQASWYK-DGVLLQEV--QDLVRRFYMGPD--GS-LSIDPTMMSDLGEYECKVRNSDG 231

  Fly   230 PSVSKRISLSIHFH-PVIQVPNQLVGAPLGTDVQIECHVEASPKSINY-WIKDTGEMIVTSGKYH 292
            ...:.:..|:|.:. .||..|.: |..|.|....::||..|:|...|. |.||.    :....|:
  Fly   232 ELQTAKAFLNIQYKAKVIYAPPE-VFLPYGQPAVLDCHFRANPPLKNLRWEKDG----LLFDSYN 291

  Fly   293 VQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLG 329
            |   ....|:...|:...|..::..|||.|...|.||
  Fly   292 V---PGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 25/92 (27%)
Ig 51..131 CDD:299845 24/92 (26%)
I-set 144..240 CDD:254352 24/113 (21%)
IGc2 159..228 CDD:197706 20/86 (23%)
Ig 244..337 CDD:299845 26/87 (30%)
I-set 244..337 CDD:254352 26/87 (30%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 25/89 (28%)
Ig 43..131 CDD:299845 24/92 (26%)
I-set 153..242 CDD:254352 19/94 (20%)
Ig 157..242 CDD:299845 18/90 (20%)
Ig_2 252..337 CDD:290606 24/82 (29%)
IG_like 260..327 CDD:214653 21/73 (29%)
I-set 341..428 CDD:254352
IGc2 356..419 CDD:197706
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.