DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and CG33543

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:346 Identity:73/346 - (21%)
Similarity:126/346 - (36%) Gaps:76/346 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 HLDQNTWNL------HIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISE---------- 149
            |:::.|..|      ||   :.||||.:.|::|    .::.|..:|.:..:|::.          
  Fly    96 HIEKKTTGLLALVFEHI---ALEDRGNWTCEVN----GNRNGNRNVNVEREFLASFELLVNQKIS 153

  Fly   150 --DTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKI 212
              .|.....|.||....:.|...|.|.|.|:| ..:|..|...::.....|:..     |.:..:
  Fly   154 FGKTEQVQSVREGRDAMVNCFVEGMPAPEVSW-LYNGEYINTVNSTKHNRLSNG-----LYIRNV 212

  Fly   213 SRNEMGSYLCIASNGVPP-SVSKRISLSIH--------FHPVIQVPNQLVGAPLGTDVQIECHVE 268
            |:.:.|.|.|.|....|. |.|.:|::.:.        |:..:.|....||..    |.:.|...
  Fly   213 SQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYVGGA----VNLSCDAM 273

  Fly   269 ASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDS 333
            ..|.....|:.:...::..:.:..|.:     |...:.:.::  .....|.|:|...|.||.::.
  Fly   274 GEPPPSFTWLHNNKGIVGFNHRIFVAD-----YGATLQLQMK--NASQFGDYKCKVANPLGMLER 331

  Fly   334 SIRLYEIP---GPNR---NKNPLNGGGKGGGAGGSLDADANDI--LKQKQQV---KVTYQPEDE- 386
            .|:|...|   ||.|   .|...|        |..||.....:  :..:.|:   :|.|..:.| 
  Fly   332 VIKLRPGPKPLGPRRFQLKKLYTN--------GFELDIQTPRMSNVSDEMQIYGYRVAYMSDTEF 388

  Fly   387 -----ELQYGSVEDFEAEGGE 402
                 ...|....||...||:
  Fly   389 KFSAGNWSYAKQRDFSFHGGK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 11/33 (33%)
Ig strand B 59..63 CDD:409353
Ig strand C 72..76 CDD:409353
Ig strand E 103..111 CDD:409353 2/13 (15%)
Ig 152..240 CDD:472250 22/88 (25%)
Ig strand B 163..167 CDD:409275 0/3 (0%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 1/2 (50%)
Ig 244..337 CDD:472250 16/92 (17%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
CG33543NP_001014458.3 Ig <71..>123 CDD:472250 9/29 (31%)
Ig strand E 105..109 CDD:409353 0/3 (0%)
Ig strand F 119..123 CDD:409353 0/3 (0%)
Ig 153..239 CDD:472250 23/91 (25%)
Ig strand B 169..173 CDD:409353 0/3 (0%)
Ig strand C 182..186 CDD:409353 2/4 (50%)
Ig strand E 205..209 CDD:409353 1/8 (13%)
Ig strand F 219..224 CDD:409353 2/4 (50%)
Ig strand G 232..235 CDD:409353 1/2 (50%)
IG_like 256..336 CDD:214653 16/90 (18%)
Ig strand B 266..270 CDD:409353 1/3 (33%)
Ig strand C 279..283 CDD:409353 0/3 (0%)
Ig strand E 302..309 CDD:409353 0/6 (0%)
Ig strand F 317..322 CDD:409353 2/4 (50%)
FN3 341..445 CDD:238020 17/77 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.