DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr4

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:265 Identity:69/265 - (26%)
Similarity:107/265 - (40%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSCDRNGKML----IHLLLIVSLLEAIGAFQPEFVE-----------SISNVSVAVGRDATFTCH 64
            |.|.|..|.:    :.|||.:......|...|.:.|           |...|:..||:.|...|.
  Fly     4 TDCPRALKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCR 68

  Fly    65 VRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLD-QNTWNLHIKAVSEEDRGGYMCQLNT 128
            ||:||...|.|::.....|..:.....|::.|....|.: .:.|.|.|.:....|.|.|.||::|
  Fly    69 VRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVST 133

  Fly   129 DPMKSQIGF-LDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEP--IVTWRREDGNEIVLK 190
            :|..|| || |:||:....|.  .::::.:..||.:.|||.|...|.|  .:.|.:         
  Fly   134 EPKISQ-GFRLNVVVSRAKIL--GNAELFIKSGSDINLTCLAMQSPVPPSFIYWYK--------- 186

  Fly   191 DNVGTKTLAPSFRGEV------------LKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHF- 242
               |.:.:..|.||.:            |.::|.:..:.|:|.|      .||.|...|:.:|. 
  Fly   187 ---GKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTC------SPSSSDSASVVVHVI 242

  Fly   243 ---HP 244
               ||
  Fly   243 NGEHP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 23/80 (29%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 2/8 (25%)
Ig 152..240 CDD:472250 22/101 (22%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 1/15 (7%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 1/2 (50%)
Ig 244..337 CDD:472250 1/1 (100%)
Ig strand B 261..265 CDD:409353
Ig strand C 274..278 CDD:409353
Ig strand E 305..309 CDD:409353
Ig strand F 319..324 CDD:409353
Ig strand G 332..335 CDD:409353
dpr4NP_001014616.2 IG_like 53..145 CDD:214653 30/92 (33%)
Ig strand A' 55..57 CDD:409355 1/1 (100%)
Ig strand B 61..69 CDD:409355 2/7 (29%)
CDR1 69..75 CDD:409355 4/5 (80%)
Ig strand C 76..82 CDD:409355 2/5 (40%)
CDR2 85..101 CDD:409355 2/15 (13%)
Ig strand D 101..106 CDD:409355 0/4 (0%)
FR3 102..131 CDD:409355 8/28 (29%)
Ig strand E 110..117 CDD:409355 2/6 (33%)
Ig strand F 125..132 CDD:409355 4/6 (67%)
IG_like 161..>227 CDD:214653 17/77 (22%)
Ig strand B 166..170 CDD:409353 1/3 (33%)
Ig strand C 181..185 CDD:409353 0/3 (0%)
Ig strand E 206..214 CDD:409353 1/7 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.