DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr4

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:265 Identity:69/265 - (26%)
Similarity:107/265 - (40%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSCDRNGKML----IHLLLIVSLLEAIGAFQPEFVE-----------SISNVSVAVGRDATFTCH 64
            |.|.|..|.:    :.|||.:......|...|.:.|           |...|:..||:.|...|.
  Fly     4 TDCPRALKAICLVPLWLLLFLDCGMVGGEVPPHYWETPYSQPYFDNSSRREVTATVGQAALLHCR 68

  Fly    65 VRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLD-QNTWNLHIKAVSEEDRGGYMCQLNT 128
            ||:||...|.|::.....|..:.....|::.|....|.: .:.|.|.|.:....|.|.|.||::|
  Fly    69 VRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSPQPRDSGTYECQVST 133

  Fly   129 DPMKSQIGF-LDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEP--IVTWRREDGNEIVLK 190
            :|..|| || |:||:....|.  .::::.:..||.:.|||.|...|.|  .:.|.:         
  Fly   134 EPKISQ-GFRLNVVVSRAKIL--GNAELFIKSGSDINLTCLAMQSPVPPSFIYWYK--------- 186

  Fly   191 DNVGTKTLAPSFRGEV------------LKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHF- 242
               |.:.:..|.||.:            |.::|.:..:.|:|.|      .||.|...|:.:|. 
  Fly   187 ---GKRVMNYSQRGGINVITERSTRTSKLLIAKATPADSGNYTC------SPSSSDSASVVVHVI 242

  Fly   243 ---HP 244
               ||
  Fly   243 NGEHP 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 23/80 (29%)
Ig 51..131 CDD:299845 24/80 (30%)
I-set 144..240 CDD:254352 23/109 (21%)
IGc2 159..228 CDD:197706 18/82 (22%)
Ig 244..337 CDD:299845 1/1 (100%)
I-set 244..337 CDD:254352 1/1 (100%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 30/93 (32%)
IG_like 53..145 CDD:214653 30/92 (33%)
ig 153..227 CDD:278476 17/87 (20%)
IG_like 161..>227 CDD:214653 17/77 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.