DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Opcml

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:342 Identity:97/342 - (28%)
Similarity:155/342 - (45%) Gaps:36/342 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHEN 89
            :.||.:|.....:.:....|.:::.||:|..|..||..|.:.. ...||.||...|  |.....:
Mouse    19 LRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDD-RVTRVAWLNRST--ILYAGND 80

  Fly    90 VITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTS 152
            ..:.:|||.:.......:::.|:.|...|.|.|.|.:.||  |..|:: .|.|.:||..:  :.|
Mouse    81 KWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVPPQIM--NIS 142

  Fly   153 SDVIVPEGSSVRLTCRARGYPEPIVTWRR---EDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISR 214
            ||:.|.|||||.|.|.|.|.|||.||||.   ::|...|.:|             |.|::|.|.|
Mouse   143 SDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSED-------------EYLEISDIKR 194

  Fly   215 NEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIK 279
            ::.|.|.|.|.|.|.....:::.:::::.|.|..... .|..:|....:.|...|.|.:...|.|
Mouse   195 DQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFK 258

  Fly   280 DTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEI---- 340
            :  :..:.:|...|:..::....|   :......:.|.|:|.|:|.|.||..::||.||||    
Mouse   259 E--DTRLATGLDGVRIENKGRIST---LTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSS 318

  Fly   341 --PGPNRNKNPLNGGGK 355
              .||....:.:|...:
Mouse   319 AVAGPGAVIDGVNSASR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 22/79 (28%)
Ig strand B 59..63 CDD:409353 2/3 (67%)
Ig strand C 72..76 CDD:409353 2/3 (67%)
Ig strand E 103..111 CDD:409353 0/7 (0%)
Ig 152..240 CDD:472250 34/90 (38%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 2/3 (67%)
Ig strand E 205..209 CDD:409275 2/3 (67%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 22/92 (24%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
OpcmlXP_006510497.1 Ig 44..132 CDD:472250 27/91 (30%)
Ig strand B 53..57 CDD:409353 2/3 (67%)
Ig strand C 65..69 CDD:409353 2/3 (67%)
Ig strand E 98..102 CDD:409353 0/3 (0%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 1/2 (50%)
Ig_3 135..206 CDD:464046 34/85 (40%)
Ig 224..312 CDD:472250 22/93 (24%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/6 (17%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.