| Sequence 1: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_808547.3 | Gene: | Sdk1 / 330222 | MGIID: | 2444413 | Length: | 2193 | Species: | Mus musculus |
| Alignment Length: | 262 | Identity: | 70/262 - (26%) |
|---|---|---|---|
| Similarity: | 117/262 - (44%) | Gaps: | 29/262 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 94 NPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQI-GFLDVV-IPPDFISEDTSSDVI 156
Fly 157 VPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSF---RGEVLKLSKISRNEMG 218
Fly 219 SYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPK-SINY-WIKDT 281
Fly 282 GEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRC--IAKNSLGEVDSSIRLYEIPGPN 344
Fly 345 RN 346 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | 12/34 (35%) |
| Ig | 51..131 | CDD:299845 | 12/36 (33%) | ||
| I-set | 144..240 | CDD:254352 | 28/98 (29%) | ||
| IGc2 | 159..228 | CDD:197706 | 21/71 (30%) | ||
| Ig | 244..337 | CDD:299845 | 21/96 (22%) | ||
| I-set | 244..337 | CDD:254352 | 21/96 (22%) | ||
| Sdk1 | NP_808547.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..56 | ||
| Ig_2 | 94..169 | CDD:290606 | |||
| IG_like | 100..169 | CDD:214653 | |||
| IG_like | 183..263 | CDD:214653 | |||
| Ig | 197..247 | CDD:299845 | |||
| IG_like | 281..357 | CDD:214653 | |||
| IGc2 | 294..347 | CDD:197706 | |||
| I-set | 368..457 | CDD:254352 | 14/46 (30%) | ||
| Ig | 388..454 | CDD:143165 | 13/43 (30%) | ||
| I-set | 462..552 | CDD:254352 | 28/98 (29%) | ||
| Ig | 476..552 | CDD:299845 | 24/82 (29%) | ||
| I-set | 557..646 | CDD:254352 | 21/95 (22%) | ||
| Ig | 562..646 | CDD:299845 | 19/90 (21%) | ||
| FN3 | 650..741 | CDD:238020 | 3/6 (50%) | ||
| fn3 | 753..839 | CDD:278470 | |||
| FN3 | 854..949 | CDD:238020 | |||
| FN3 | 954..1036 | CDD:238020 | |||
| FN3 | 1052..1148 | CDD:238020 | |||
| FN3 | 1158..1253 | CDD:238020 | |||
| FN3 | 1261..1349 | CDD:238020 | |||
| FN3 | 1360..1453 | CDD:238020 | |||
| FN3 | 1459..1554 | CDD:238020 | |||
| FN3 | 1562..1676 | CDD:238020 | |||
| FN3 | 1686..1779 | CDD:238020 | |||
| FN3 | 1784..1865 | CDD:238020 | |||
| FN3 | 1885..1978 | CDD:238020 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 2057..2080 | ||||
| PDZ-binding. /evidence=ECO:0000250|UniProtKB:Q6V4S5 | 2187..2193 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||