DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and CG6867

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_573262.2 Gene:CG6867 / 32782 FlyBaseID:FBgn0030887 Length:949 Species:Drosophila melanogaster


Alignment Length:315 Identity:96/315 - (30%)
Similarity:148/315 - (46%) Gaps:58/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 DVVIPP---DFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAP 200
            |::|||   |....|....|||.||.|:.|:|.|.|.|.|.|.||||||..|    ||....:| 
  Fly   426 DLLIPPSITDIQVPDFQRTVIVEEGRSLNLSCTATGTPTPQVEWRREDGRTI----NVNGVEMA- 485

  Fly   201 SFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIEC 265
            |..|:.|:.:.|:|::|.:|.|.|:||:.|..:....:.:.|.|:|.|..|::.|...:...:||
  Fly   486 SISGQFLRFTNITRHQMAAYTCFANNGIAPVANATYLVEVQFAPMISVYRQMIYAEYQSSATLEC 550

  Fly   266 HVEASPKSINYWIKD-TGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLG 329
            .|||.|::|.||.:. .|:::..|.||.: ||....::|.|.:.:...:|||.|.|.|:|:|   
  Fly   551 LVEAFPEAIRYWERAYDGKILDPSDKYGI-ESYPEGFKTTMRLTISNLRKDDFGYYHCVARN--- 611

  Fly   330 EVDSSIRLYEI-PGPNRNKNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTYQ--PEDE----- 386
            |:::::..:|| |....::.|..|                      ..:||..|  ||.|     
  Fly   612 ELNATMVNFEIAPQDPNSETPYVG----------------------NNMKVYGQRPPESECPVCD 654

  Fly   387 --------ELQYGSVEDFEAEGGEGGGLT----PLSPHV-YYTSGNKPATHKPGN 428
                    :.:...:.:||.:.  .|.|:    |..|.. |..:..||..||..|
  Fly   655 QCPDPSLYQCKDSILNNFEIQA--TGNLSYPGLPKRPKTCYLYAVGKPVFHKVVN 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653
Ig 51..131 CDD:299845
I-set 144..240 CDD:254352 38/98 (39%)
IGc2 159..228 CDD:197706 30/68 (44%)
Ig 244..337 CDD:299845 31/93 (33%)
I-set 244..337 CDD:254352 31/93 (33%)
CG6867NP_573262.2 Collagen 306..364 CDD:189968
IG_like 442..525 CDD:214653 35/87 (40%)
IGc2 449..511 CDD:197706 29/66 (44%)
IG_like 544..612 CDD:214653 25/71 (35%)
Ig 546..612 CDD:143165 25/69 (36%)
OLF 694..937 CDD:280371 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11661
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26286
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.