DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr8

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:219 Identity:61/219 - (27%)
Similarity:94/219 - (42%) Gaps:22/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GAFQPEFVESI-SNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSH 101
            |...|.|..:| :|::..||:....||.|::||...|.|::.....:..:.....|.:.|....|
  Fly    38 GTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMH 102

  Fly   102 LDQ-NTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIP-PDFISEDTSSDVIVPEGSSVR 164
            ... ..|.|.|:....:|.|.|.||::|.|......:|::|.| .|.|.   ..::.:..||::.
  Fly   103 SPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIG---GPELHINRGSTIN 164

  Fly   165 LTCRARGYPE--PIVTWRREDGNEIVLKDN-------VGTKTLAPSFRGEVLKLSKISRNEMGSY 220
            |||..:..||  |.|.|  ....||:..|:       |..|.:..:.|   |.:.|....:.|.|
  Fly   165 LTCIVKFAPEPPPTVIW--SHNREIINFDSPRGGISLVTEKGVLTTSR---LLVQKAITQDSGLY 224

  Fly   221 LCIASNGVPPSVSKRISLSIHFHP 244
            .|..||..|.||  |:.:....||
  Fly   225 TCTPSNANPTSV--RVHIVDGEHP 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 21/80 (26%)
Ig 51..131 CDD:299845 21/80 (26%)
I-set 144..240 CDD:254352 29/104 (28%)
IGc2 159..228 CDD:197706 23/77 (30%)
Ig 244..337 CDD:299845 1/1 (100%)
I-set 244..337 CDD:254352 1/1 (100%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 21/79 (27%)
V-set 52..143 CDD:284989 23/90 (26%)
IG_like 153..238 CDD:214653 26/91 (29%)
ig 153..232 CDD:278476 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.