DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Negr1

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_036019026.1 Gene:Negr1 / 320840 MGIID:2444846 Length:362 Species:Mus musculus


Alignment Length:370 Identity:98/370 - (26%)
Similarity:164/370 - (44%) Gaps:62/370 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SCDRNGKMLIHLLLIVSLLEAIGAFQPEFVE----SISNVSVAVGRDATFTCHVRHLGGYRVGWL 76
            :|..|..:...||.:.|.|.|     .:.|:    ::.|:.|..|..|...|::.. |..:..||
Mouse     8 ACCSNQWLAAVLLSLCSCLPA-----GQSVDFPWAAVDNMLVRKGDTAVLRCYLED-GASKGAWL 66

  Fly    77 KADTKAIQAIHENVI-------THNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTD--PMK 132
            .         ..::|       :.:|||::|.|::..::|.|:.|...|.|.|.|.:.|.  |..
Mouse    67 N---------RSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRT 122

  Fly   133 SQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKT 197
            .|: .|.|.:||...  |.|:|:.:.||::|.|||.|.|.|||:::||.                
Mouse   123 MQV-HLTVQVPPKIY--DISNDMTINEGTNVTLTCLATGKPEPVISWRH---------------- 168

  Fly   198 LAPSFR----GEVLKLSKISRNEMGSYLCIASNGVP-PSVSKRISLSIHFHPVIQVPNQLVGAPL 257
            ::||.:    |:.|.:..|:|::.|.|.|.|.|.|. |.| |::.:.::|.|.||........| 
Mouse   169 ISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDV-KKVRVIVNFAPTIQEIKSGTVTP- 231

  Fly   258 GTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRC 322
            |....|.|.....|.....|.|  ||..:.:|:..:...:   :.|:..:.|....::..|:|.|
Mouse   232 GRSGLIRCEGAGVPPPAFEWYK--GEKRLFNGQQGIIIQN---FSTRSILTVTNVTQEHFGNYTC 291

  Fly   323 IAKNSLGEVDSSIRLYEIPGPNRNK---NPLNGGGKGGGAGGSLD 364
            :|.|.||..::|:.|.:|..|..:.   :|.....:.|..|.:.|
Mouse   292 VAANKLGTTNASLPLNQIIEPTTSSPVTSPAPSTAQYGITGSACD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 21/86 (24%)
Ig 51..131 CDD:299845 21/88 (24%)
I-set 144..240 CDD:254352 32/100 (32%)
IGc2 159..228 CDD:197706 24/72 (33%)
Ig 244..337 CDD:299845 23/92 (25%)
I-set 244..337 CDD:254352 23/92 (25%)
Negr1XP_036019026.1 FR1 38..55 CDD:409353 4/16 (25%)
Ig strand A' 40..46 CDD:409353 2/5 (40%)
IG_like 41..129 CDD:214653 25/98 (26%)
Ig strand B 48..56 CDD:409353 2/7 (29%)
CDR1 56..60 CDD:409353 0/4 (0%)
FR2 61..68 CDD:409353 2/15 (13%)
Ig strand C 61..67 CDD:409353 1/5 (20%)
CDR2 69..79 CDD:409353 1/9 (11%)
Ig strand C' 71..74 CDD:409353 1/2 (50%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 12/34 (35%)
Ig strand D 84..91 CDD:409353 3/6 (50%)
Ig strand E 94..100 CDD:409353 1/5 (20%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 2/7 (29%)
Ig strand A' 139..144 CDD:409353 2/4 (50%)
IGc2 146..204 CDD:197706 24/73 (33%)
Ig strand B 150..157 CDD:409353 4/6 (67%)
Ig strand C 163..168 CDD:409353 1/4 (25%)
Ig strand C' 170..172 CDD:409353 0/1 (0%)
Ig strand E 180..186 CDD:409353 1/5 (20%)
Ig strand F 193..200 CDD:409353 3/6 (50%)
Ig_3 219..295 CDD:404760 19/81 (23%)
putative Ig strand A 219..225 CDD:409353 3/5 (60%)
Ig strand B 235..239 CDD:409353 1/3 (33%)
Ig strand C 248..252 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 0/3 (0%)
Ig strand F 288..293 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.