DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Prtg

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001032740.2 Gene:Prtg / 315806 RGDID:1307157 Length:1193 Species:Rattus norvegicus


Alignment Length:356 Identity:88/356 - (24%)
Similarity:143/356 - (40%) Gaps:57/356 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FQFTSCDRNGKML---IHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRV 73
            :|..:.::.|.:|   .||     .|..|.||:   |..:| ..|..|..|.|:|.:.......:
  Rat   105 YQCLAVNKYGAILSQKAHL-----TLSTISAFE---VHPVS-TEVPEGGVARFSCKISSTPPAVI 160

  Fly    74 GWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFL 138
            .| :.:..|:....::.:|..|          :..|.|.....||.|.|.|...|...|.:....
  Rat   161 TW-EFNRTALPMTMDSRVTALP----------SGVLQIYDAGPEDAGKYRCVAATHAHKRKSMEA 214

  Fly   139 DVVIPPDFISEDTSS-----------DVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDN 192
            .:.|.|   :.:|.|           :|......:|.|.|.|.|||:||::|.|.|...|   |.
  Rat   215 SLTIVP---ANETRSFYMPTIIASPQNVTASLHQTVVLECMATGYPKPIISWSRLDHKSI---DV 273

  Fly   193 VGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASN-GVPPSVSKRISLSIHFHP-VIQVPNQLVGA 255
            ..|:.|.   .|.:: :|.:.....|.|:|.|:. |.........:|::...| .::.|..|...
  Rat   274 FNTRVLG---NGNLI-ISDVKLQHAGVYVCRATTPGTRNFTVAMATLTVLAPPSFVEWPESLTRP 334

  Fly   256 PLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSY 320
            ..|| .:..|..|..|.....|:|: |..|.::|:.       .||.:|  :::.:...:|...|
  Rat   335 RAGT-ARFVCQAEGIPSPKMSWLKN-GRRIHSNGRI-------KMYNSK--LVINQIIPEDDAIY 388

  Fly   321 RCIAKNSLGEVDSSIRLYEIPGPNRNKNPLN 351
            :|:|:||.|.|.|..||..:...:|...|.|
  Rat   389 QCMAENSQGSVLSRARLTVVMSEDRPSAPYN 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 17/79 (22%)
Ig 51..131 CDD:299845 17/79 (22%)
I-set 144..240 CDD:254352 28/107 (26%)
IGc2 159..228 CDD:197706 22/69 (32%)
Ig 244..337 CDD:299845 25/93 (27%)
I-set 244..337 CDD:254352 25/93 (27%)
PrtgNP_001032740.2 Ig 32..124 CDD:416386 5/23 (22%)
Ig strand A 32..35 CDD:409353
Ig strand A' 38..44 CDD:409353
Ig strand B 48..58 CDD:409353
Ig strand C 62..68 CDD:409353
Ig strand C' 70..73 CDD:409353
Ig strand D 78..83 CDD:409353
Ig strand E 85..91 CDD:409353
Ig strand F 103..110 CDD:409353 1/4 (25%)
Ig strand G 114..124 CDD:409353 4/14 (29%)
Ig 131..218 CDD:416386 21/101 (21%)
Ig strand B 146..150 CDD:409353 2/3 (67%)
Ig strand C 159..163 CDD:409353 1/4 (25%)
Ig strand E 183..187 CDD:409353 1/3 (33%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
Ig strand G 211..214 CDD:409353 0/2 (0%)
Ig_3 230..302 CDD:404760 22/78 (28%)
Ig strand B 247..251 CDD:409353 2/3 (67%)
Ig strand C 260..264 CDD:409353 1/3 (33%)
Ig strand E 282..286 CDD:409353 1/4 (25%)
Ig strand F 296..301 CDD:409353 2/4 (50%)
I-set 322..407 CDD:400151 27/95 (28%)
Ig strand C 352..357 CDD:409353 1/4 (25%)
Ig strand C' 359..362 CDD:409353 1/2 (50%)
Ig strand D 367..371 CDD:409353 0/10 (0%)
Ig strand E 373..378 CDD:409353 1/6 (17%)
Ig strand F 387..394 CDD:409353 3/6 (50%)
Ig strand G 398..407 CDD:409353 4/8 (50%)
FN3 414..507 CDD:238020 2/6 (33%)
FN3 512..605 CDD:238020
fn3 619..694 CDD:394996
FN3 721..809 CDD:238020
FN3 816..906 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 974..1018
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1078..1193
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.