DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Iglon5

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_218634.5 Gene:Iglon5 / 308557 RGDID:1305344 Length:336 Species:Rattus norvegicus


Alignment Length:321 Identity:95/321 - (29%)
Similarity:144/321 - (44%) Gaps:51/321 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EFVESISNVSVAVGRDATFTCHV-RHLGGYRVGWLKADTKAIQAIHENVI-------THNPRVTV 99
            ||.....|.:|..|.:||.:|.: .|:  .||.||.         ..|::       |.:|||.:
  Rat    34 EFSSPADNYTVCEGDNATLSCFIDEHV--TRVAWLN---------RSNILYAGNDRWTSDPRVRL 87

  Fly   100 SHLDQNTWNLHIKAVSEEDRGGYMCQLNT--DPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSS 162
            .......:::.|..|...|.|.|.|...|  .|..:|: :|.|.:|...:  :.||.|.|.||.:
  Rat    88 LINTPEEFSILITQVGLGDEGLYTCSFQTRHQPYTTQV-YLIVHVPARIV--NISSPVAVNEGGN 149

  Fly   163 VRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNG 227
            |.|.|.|.|.|||.||||:       |:|...::       ||:|::|.|.|.:.|.|.|:..||
  Rat   150 VNLLCLAVGRPEPTVTWRQ-------LRDGFTSE-------GEILEISDIQRGQAGEYECVTHNG 200

  Fly   228 VPPSV-SKRISLSIHFHPVIQVPNQLVGA--PLGTDVQIECHVEASPKSINYWIKDTGEMIVTSG 289
            |..:. |:|:.:::::.|.|   ..:..|  .||....:.|...|.|.:...|.||  :.:::||
  Rat   201 VNSAPDSRRVLVTVNYPPTI---TDVTSARTALGRAALLRCEAMAVPPADFQWYKD--DRLLSSG 260

  Fly   290 KYHVQESSQSMYETKMSMIV-RKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNP 349
            .   .|..:...|...||:: ........|:|.|.|.|.||...:|:||.. ||...|..|
  Rat   261 S---AEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGASSASMRLLR-PGSLENSAP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 23/89 (26%)
Ig 51..131 CDD:299845 22/89 (25%)
I-set 144..240 CDD:254352 34/96 (35%)
IGc2 159..228 CDD:197706 26/68 (38%)
Ig 244..337 CDD:299845 25/95 (26%)
I-set 244..337 CDD:254352 25/95 (26%)
Iglon5XP_218634.5 Ig 41..129 CDD:416386 26/99 (26%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 0/3 (0%)
FR2 61..68 CDD:409353 4/15 (27%)
Ig strand C 61..67 CDD:409353 3/5 (60%)
CDR2 69..79 CDD:409353 1/9 (11%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 0/2 (0%)
FR3 80..115 CDD:409353 10/34 (29%)
Ig strand D 84..91 CDD:409353 2/6 (33%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 2/7 (29%)
Ig strand A 132..137 CDD:409353 1/6 (17%)
Ig_3 134..199 CDD:404760 29/80 (36%)
Ig strand A' 140..145 CDD:409353 2/4 (50%)
Ig strand B 148..157 CDD:409353 3/8 (38%)
Ig strand C 163..167 CDD:409353 2/3 (67%)
Ig strand D 174..177 CDD:409353 0/9 (0%)
Ig strand E 178..183 CDD:409353 2/4 (50%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 21/85 (25%)
putative Ig strand A 218..224 CDD:409353 2/8 (25%)
Ig strand B 234..238 CDD:409353 0/3 (0%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I11853
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.