DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Lsamp

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:339 Identity:95/339 - (28%)
Similarity:149/339 - (43%) Gaps:48/339 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTW 107
            :|.....|::|..|..|...|.|..... :|.||.. :..|.|.|:. .:.:|||.:.......:
  Rat    50 DFNRGTDNITVRQGDTAILRCVVEDKNS-KVAWLNR-SGIIFAGHDK-WSLDPRVELEKRHALEY 111

  Fly   108 NLHIKAVSEEDRGGYMCQLNT--DPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRAR 170
            :|.|:.|...|.|.|.|.:.|  :|..||: :|.|.:||..  .:.||||.|.|||:|.|.|.|.
  Rat   112 SLRIQKVDVYDEGSYTCSVQTQHEPKTSQV-YLIVQVPPKI--SNISSDVTVNEGSNVTLVCMAN 173

  Fly   171 GYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRG--EVLKLSKISRNEMGSYLCIASNGVPPSVS 233
            |.|||::|||.             ...|...|.|  |.|::..|:|.:.|.|.|.|:|.|..:..
  Rat   174 GRPEPVITWRH-------------LTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADV 225

  Fly   234 KRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQ 298
            |::.:::::.|.| ..::...|..|....::|...|.|.....|.:|...:...:|........|
  Rat   226 KQVKVTVNYPPTI-TESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQ 289

  Fly   299 SMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYE-----IPGP---------NRNKNP 349
            |      |:.|....::..|:|.|:|.|.||..::|:.|::     :|.|         .:.|.|
  Rat   290 S------SLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVPHPIQEIGTTVHFKQKGP 348

  Fly   350 LNGGGKGGGAGGSL 363
                |...|..||:
  Rat   349 ----GSVRGINGSI 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 23/81 (28%)
Ig 51..131 CDD:299845 22/81 (27%)
I-set 144..240 CDD:254352 34/97 (35%)
IGc2 159..228 CDD:197706 26/70 (37%)
Ig 244..337 CDD:299845 22/92 (24%)
I-set 244..337 CDD:254352 22/92 (24%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 27/93 (29%)
FR1 55..71 CDD:409353 4/15 (27%)
Ig strand A' 56..62 CDD:409353 2/5 (40%)
Ig strand B 64..72 CDD:409353 2/7 (29%)
CDR1 72..76 CDD:409353 1/3 (33%)
FR2 77..84 CDD:409353 3/7 (43%)
Ig strand C 77..83 CDD:409353 2/6 (33%)
CDR2 85..95 CDD:409353 3/10 (30%)
Ig strand C' 87..90 CDD:409353 1/2 (50%)
Ig strand C' 92..95 CDD:409353 1/3 (33%)
FR3 96..131 CDD:409353 10/34 (29%)
Ig strand D 100..107 CDD:409353 2/6 (33%)
Ig strand E 110..116 CDD:409353 1/5 (20%)
Ig strand F 123..131 CDD:409353 3/7 (43%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 4/9 (44%)
FR4 138..145 CDD:409353 3/7 (43%)
Ig_3 148..218 CDD:404760 32/84 (38%)
Ig strand A' 155..160 CDD:409353 4/4 (100%)
Ig strand B 166..173 CDD:409353 3/6 (50%)
Ig strand C 179..184 CDD:409353 2/4 (50%)
Ig strand D 190..193 CDD:409353 0/2 (0%)
Ig strand E 197..203 CDD:409353 2/5 (40%)
Ig strand F 210..217 CDD:409353 3/6 (50%)
Ig strand G 224..232 CDD:409353 1/7 (14%)
Ig_3 235..311 CDD:404760 18/82 (22%)
Ig strand B 252..256 CDD:409353 0/3 (0%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 2/9 (22%)
Ig strand F 304..309 CDD:409353 2/4 (50%)
Ig strand G 318..321 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I11853
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.