DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Ncam2

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_981954.2 Gene:Ncam2 / 288280 RGDID:1303131 Length:837 Species:Rattus norvegicus


Alignment Length:338 Identity:81/338 - (23%)
Similarity:127/338 - (37%) Gaps:65/338 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWN 108
            |.|.:|......|.||...|.|.......|.||         .|...:|..|....:.|..|  |
  Rat   117 FREVLSPQEFKQGEDAEVVCRVSSSPAPAVSWL---------YHNEEVTTIPDNRFAVLANN--N 170

  Fly   109 LHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVV----IPPDFISEDTSSDVIVPEGSSVRLTCRA 169
            |.|..:::.|.|.|.|:...: .:.:|.|.|::    :||..:....|.:.....|..:.|||:|
  Rat   171 LQILNINKSDEGIYRCEGRVE-ARGEIDFRDIIVIVNVPPAIVMPQKSFNATAERGEEMTLTCKA 234

  Fly   170 RGYPEPIVTWRR-----EDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVP 229
            .|.|:|.::|.|     |:..:.:||   |:.|        .|.:..|...:.|||:|.|:|...
  Rat   235 SGSPDPAISWFRNGKLIEENEKYILK---GSNT--------ELTVRNIINKDGGSYVCKATNKAG 288

  Fly   230 PSVSKRISLSIHFHP-VIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHV 293
            .. .|:..|.:...| ::|:.|:....  ...|.:.|..|..|.....|.:....:..:.|    
  Rat   289 ED-QKQAFLQVFVQPHILQLKNETTSE--NGHVTLICEAEGEPVPEITWKRAIDGVTFSEG---- 346

  Fly   294 QESSQSMYETK-----MSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRL---------------Y 338
            .:|.....|.|     .|:.:|..:..|.|.|.|.|.:.:|....|:.|               |
  Rat   347 DKSPDGRIEVKGQHGRSSLHIRDVKLSDSGRYDCEAASRIGGHQRSMHLDIEYAPKFVSNQTMYY 411

  Fly   339 EIPGPNRNKNPLN 351
            ...|     ||:|
  Rat   412 SWEG-----NPIN 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 21/79 (27%)
Ig 51..131 CDD:299845 20/79 (25%)
I-set 144..240 CDD:254352 27/100 (27%)
IGc2 159..228 CDD:197706 23/73 (32%)
Ig 244..337 CDD:299845 21/98 (21%)
I-set 244..337 CDD:254352 21/98 (21%)
Ncam2NP_981954.2 IgI_1_NCAM-2 21..113 CDD:409452
Ig strand B 38..42 CDD:409452
Ig strand C 50..54 CDD:409452
Ig strand E 76..80 CDD:409452
Ig strand F 90..95 CDD:409452
Ig strand G 104..107 CDD:409452
IGc2 128..189 CDD:197706 20/71 (28%)
Ig strand B 130..139 CDD:409353 3/8 (38%)
Ig strand C 145..153 CDD:409353 4/16 (25%)
Ig strand C' 156..159 CDD:409353 1/2 (50%)
Ig strand D 162..167 CDD:409353 0/4 (0%)
Ig strand E 168..175 CDD:409353 4/8 (50%)
IgI_1_MuSK 209..298 CDD:409562 27/100 (27%)
Ig strand B 228..232 CDD:409562 1/3 (33%)
Ig strand C 241..245 CDD:409562 0/3 (0%)
Ig strand E 264..268 CDD:409562 2/11 (18%)
Ig strand F 278..283 CDD:409562 3/4 (75%)
Ig strand G 291..294 CDD:409562 1/2 (50%)
Ig 300..397 CDD:416386 22/102 (22%)
Ig strand A 300..305 CDD:409353 1/4 (25%)
Ig strand A' 309..313 CDD:409353 1/3 (33%)
Ig strand B 317..325 CDD:409353 2/7 (29%)
Ig strand C 331..337 CDD:409353 1/5 (20%)
Ig strand C' 340..343 CDD:409353 0/2 (0%)
Ig strand D 353..359 CDD:409353 2/5 (40%)
Ig strand E 362..368 CDD:409353 1/5 (20%)
Ig strand F 376..384 CDD:409353 4/7 (57%)
Ig strand G 387..397 CDD:409353 3/9 (33%)
Ig_3 401..479 CDD:404760 5/24 (21%)
Ig strand B 418..422 CDD:409353 1/2 (50%)
Ig strand C 431..435 CDD:409353
Ig strand E 458..462 CDD:409353
Ig strand F 472..477 CDD:409353
Ig strand G 486..489 CDD:409353
FN3 496..588 CDD:238020
fn3 594..678 CDD:394996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.