DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr7

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:223 Identity:57/223 - (25%)
Similarity:91/223 - (40%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FVESIS--NVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITH--NPRVTVSH-LD 103
            |.:.||  |||..|...|...|.|::.|...|.|::  .:.:..:..|:.|:  :.|.:|.| ..
  Fly    52 FFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMR--KRDLHILTTNIYTYTGDQRFSVIHPPG 114

  Fly   104 QNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDT----------------S 152
            ...|:|.|......|.|.|.||:||:|..:....|.|:...||....|                |
  Fly   115 SEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGS 179

  Fly   153 SDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIV-------------LKDNVGTKTLAPSFRG 204
            :::.|...|::.|.|....: .|.|.|..  |:.:|             .|.:|||.:.      
  Fly   180 TEIHVKRDSTIALACSVNIH-APSVIWYH--GSSVVDFDSLRGGISLETEKTDVGTTSR------ 235

  Fly   205 EVLKLSKISRNEMGSYLCIASNGVPPSV 232
              |.|::.|..:.|:|.|:.:..:|.||
  Fly   236 --LMLTRASLRDSGNYTCVPNGAIPASV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 25/84 (30%)
Ig 51..131 CDD:299845 24/82 (29%)
I-set 144..240 CDD:254352 26/118 (22%)
IGc2 159..228 CDD:197706 18/81 (22%)
Ig 244..337 CDD:299845
I-set 244..337 CDD:254352
dpr7NP_001096850.2 V-set 56..145 CDD:284989 28/90 (31%)
IG_like 58..140 CDD:214653 24/83 (29%)
IG_like 179..265 CDD:214653 23/94 (24%)
Ig 187..257 CDD:299845 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.