DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr7

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:223 Identity:57/223 - (25%)
Similarity:91/223 - (40%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 FVESIS--NVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITH--NPRVTVSH-LD 103
            |.:.||  |||..|...|...|.|::.|...|.|::  .:.:..:..|:.|:  :.|.:|.| ..
  Fly    52 FFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMR--KRDLHILTTNIYTYTGDQRFSVIHPPG 114

  Fly   104 QNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDT----------------S 152
            ...|:|.|......|.|.|.||:||:|..:....|.|:...||....|                |
  Fly   115 SEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGS 179

  Fly   153 SDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIV-------------LKDNVGTKTLAPSFRG 204
            :::.|...|::.|.|....: .|.|.|..  |:.:|             .|.:|||.:.      
  Fly   180 TEIHVKRDSTIALACSVNIH-APSVIWYH--GSSVVDFDSLRGGISLETEKTDVGTTSR------ 235

  Fly   205 EVLKLSKISRNEMGSYLCIASNGVPPSV 232
              |.|::.|..:.|:|.|:.:..:|.||
  Fly   236 --LMLTRASLRDSGNYTCVPNGAIPASV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 25/84 (30%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 2/7 (29%)
Ig 152..240 CDD:472250 23/94 (24%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 57/223 (26%)
Ig 244..337 CDD:472250
Ig strand B 261..265 CDD:409353
Ig strand C 274..278 CDD:409353
Ig strand E 305..309 CDD:409353
Ig strand F 319..324 CDD:409353
Ig strand G 332..335 CDD:409353
dpr7NP_001096850.2 V-set 56..145 CDD:462230 28/90 (31%)
Ig 184..267 CDD:472250 22/89 (25%)
Ig strand B 190..194 CDD:409353 1/3 (33%)
Ig strand C 202..206 CDD:409353 1/3 (33%)
Ig strand E 234..238 CDD:409353 1/11 (9%)
Ig strand G 261..264 CDD:409353 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.