DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr9

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001287332.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:253 Identity:70/253 - (27%)
Similarity:105/253 - (41%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VSLLEAIGAFQPEFVESIS-NVSVAVGRDATFTCHVRHLGG----YRVGWLKADTKAIQAIHENV 90
            :.|.||..| .|.|.::.| ||:..:|:.|...|.|::||.    .:|.|::.....:..:....
  Fly   246 IDLEEARNA-GPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYT 309

  Fly    91 ITHNPRVTVSHLDQ-NTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSD 154
            .|.:.|....|..| ..|.|.||.....|.|.|.||::|.|..|....|:||.|...|.  .:.|
  Fly   310 YTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEII--GAPD 372

  Fly   155 VIVPEGSSVRLTCRARGYPEP-----------------IVTWRREDGNEIVLKDNVGTKTLAPSF 202
            :.:..||::.|||..:..|||                 |:.:....|...|:.:...|.|   ||
  Fly   373 LYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTT---SF 434

  Fly   203 RGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQ-VPNQLVGAPLGT 259
                |.:.....::.|.|.|..||..|.||:..:...:. |.|.: ||:.  .|..||
  Fly   435 ----LLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVS-HSVSRGVPSS--NAARGT 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 24/85 (28%)
Ig 51..131 CDD:299845 23/84 (27%)
I-set 144..240 CDD:254352 26/112 (23%)
IGc2 159..228 CDD:197706 21/85 (25%)
Ig 244..337 CDD:299845 6/17 (35%)
I-set 244..337 CDD:254352 6/17 (35%)
dpr9NP_001287332.1 Ig 263..361 CDD:299845 28/97 (29%)
IG_like 263..360 CDD:214653 28/96 (29%)
IG_like 371..464 CDD:214653 25/99 (25%)
IGc2 377..456 CDD:197706 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.