DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dpr9

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_996215.1 Gene:dpr9 / 2768670 FlyBaseID:FBgn0038282 Length:602 Species:Drosophila melanogaster


Alignment Length:253 Identity:70/253 - (27%)
Similarity:105/253 - (41%) Gaps:37/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VSLLEAIGAFQPEFVESIS-NVSVAVGRDATFTCHVRHLGG----YRVGWLKADTKAIQAIHENV 90
            :.|.||..| .|.|.::.| ||:..:|:.|...|.|::||.    .:|.|::.....:..:....
  Fly   246 IDLEEARNA-GPYFDKAFSKNVTALLGKTAYLNCRVKNLGNKTMLLQVSWVRHRDIHLLTVGRYT 309

  Fly    91 ITHNPRVTVSHLDQ-NTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSD 154
            .|.:.|....|..| ..|.|.||.....|.|.|.||::|.|..|....|:||.|...|.  .:.|
  Fly   310 YTSDQRFRAIHQPQTEDWMLQIKYPQHRDSGIYECQVSTTPHMSHYIHLNVVEPSTEII--GAPD 372

  Fly   155 VIVPEGSSVRLTCRARGYPEP-----------------IVTWRREDGNEIVLKDNVGTKTLAPSF 202
            :.:..||::.|||..:..|||                 |:.:....|...|:.:...|.|   ||
  Fly   373 LYIESGSTINLTCIIQNSPEPPAYIFWNHNNAFPSHPQIINYDSPRGGVSVVTNKGDTTT---SF 434

  Fly   203 RGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQ-VPNQLVGAPLGT 259
                |.:.....::.|.|.|..||..|.||:..:...:. |.|.: ||:.  .|..||
  Fly   435 ----LLIKSARPSDSGHYQCNPSNAKPKSVTVHVLNGVS-HSVSRGVPSS--NAARGT 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 24/85 (28%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 3/8 (38%)
Ig 152..240 CDD:472250 25/104 (24%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 6/17 (35%)
Ig strand B 261..265 CDD:409353
Ig strand C 274..278 CDD:409353
Ig strand E 305..309 CDD:409353
Ig strand F 319..324 CDD:409353
Ig strand G 332..335 CDD:409353
dpr9NP_996215.1 IG_like 263..360 CDD:214653 28/96 (29%)
Ig strand B 274..278 CDD:409355 1/3 (33%)
Ig strand C 291..295 CDD:409355 1/3 (33%)
Ig strand E 327..331 CDD:409355 2/3 (67%)
Ig strand F 341..346 CDD:409355 2/4 (50%)
IG_like 371..464 CDD:214653 25/99 (25%)
Ig strand B 381..385 CDD:143220 1/3 (33%)
Ig strand C 396..400 CDD:143220 0/3 (0%)
Ig strand E 431..437 CDD:143220 4/12 (33%)
Ig strand F 447..452 CDD:143220 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.