DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Ncam1

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_038936733.1 Gene:Ncam1 / 24586 RGDID:67378 Length:1136 Species:Rattus norvegicus


Alignment Length:328 Identity:78/328 - (23%)
Similarity:118/328 - (35%) Gaps:77/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GRDATFTCHV----------RHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWNLH 110
            |.||...|.|          :|.|  |...||.|.:.|      |:::|             .|.
  Rat   132 GEDAVIVCDVVSSLPPTIIWKHKG--RDVILKKDVRFI------VLSNN-------------YLQ 175

  Fly   111 IKAVSEEDRGGYMCQLNTDPMKSQIGFLD----VVIPPDFISEDTSSDVIVPEGSSVRLTCRARG 171
            |:.:.:.|.|.|.|: .....:.:|.|.|    |.:||...:..:..:.....|.||.|.|.|.|
  Rat   176 IRGIKKTDEGTYRCE-G
RILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADG 239

  Fly   172 YPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRI 236
            :|||.::|.: ||..|..::....|.:......| |.:..:.:|:...|:|||.|..... ...|
  Rat   240 FPEPTMSWTK-DGEPIENEEEDDEKHIFSDDSSE-LTIRNVDKNDEAEYVCIAENKAGEQ-DASI 301

  Fly   237 SLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDT-------------------- 281
            .|.:...|.|..........|...|.:.|.....|.....|...|                    
  Rat   302 HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETL 366

  Fly   282 -GEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLY-----EI 340
             |.|:|.|   |.:.|         |:.::..|..|.|.|.|.|.|::|:...|:.|.     ::
  Rat   367 DGHMVVRS---HARVS---------SLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKL 419

  Fly   341 PGP 343
            .||
  Rat   420 QGP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 20/82 (24%)
Ig 51..131 CDD:299845 20/84 (24%)
I-set 144..240 CDD:254352 26/95 (27%)
IGc2 159..228 CDD:197706 23/68 (34%)
Ig 244..337 CDD:299845 24/113 (21%)
I-set 244..337 CDD:254352 24/113 (21%)
Ncam1XP_038936733.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand B 37..41 CDD:409451
Ig strand C 51..55 CDD:409451
Ig strand E 79..83 CDD:409451
Ig strand F 93..98 CDD:409451
Ig strand G 107..110 CDD:409451
IG_like 124..190 CDD:214653 19/78 (24%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 2/16 (13%)
Ig strand F 186..191 CDD:409353 2/5 (40%)
IgI_3_NCAM-1 211..308 CDD:143207 27/99 (27%)
Ig strand B 231..235 CDD:143207 2/3 (67%)
Ig strand C 244..248 CDD:143207 0/3 (0%)
Ig strand E 271..275 CDD:143207 2/4 (50%)
Ig strand F 285..290 CDD:143207 2/4 (50%)
Ig strand G 298..301 CDD:143207 0/2 (0%)
IgI_NCAM-1 307..413 CDD:143277 25/117 (21%)
Ig strand B 326..330 CDD:143277 1/3 (33%)
Ig strand C 339..343 CDD:143277 0/3 (0%)
Ig strand E 379..383 CDD:143277 2/12 (17%)
Ig strand F 393..398 CDD:143277 2/4 (50%)
Ig strand G 406..409 CDD:143277 0/2 (0%)
Ig_3 422..494 CDD:404760 1/1 (100%)
Ig strand B 433..437 CDD:409353
Ig strand C 446..450 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
FN3 509..606 CDD:238020
fn3 619..701 CDD:394996
Herpes_BLLF1 <842..1133 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.