Sequence 1: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
Alignment Length: | 321 | Identity: | 95/321 - (29%) |
---|---|---|---|
Similarity: | 144/321 - (44%) | Gaps: | 51/321 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 43 EFVESISNVSVAVGRDATFTCHV-RHLGGYRVGWLKADTKAIQAIHENVI-------THNPRVTV 99
Fly 100 SHLDQNTWNLHIKAVSEEDRGGYMCQLNT--DPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSS 162
Fly 163 VRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNG 227
Fly 228 VPPSV-SKRISLSIHFHPVIQVPNQLVGA--PLGTDVQIECHVEASPKSINYWIKDTGEMIVTSG 289
Fly 290 KYHVQESSQSMYETKMSMIV-RKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNP 349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | 23/89 (26%) |
Ig | 51..131 | CDD:299845 | 22/89 (25%) | ||
I-set | 144..240 | CDD:254352 | 34/96 (35%) | ||
IGc2 | 159..228 | CDD:197706 | 26/68 (38%) | ||
Ig | 244..337 | CDD:299845 | 25/95 (26%) | ||
I-set | 244..337 | CDD:254352 | 25/95 (26%) | ||
Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 26/99 (26%) |
Ig strand A' | 41..46 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
FR2 | 61..68 | CDD:409353 | 4/15 (27%) | ||
Ig strand C | 61..67 | CDD:409353 | 3/5 (60%) | ||
CDR2 | 69..79 | CDD:409353 | 1/9 (11%) | ||
Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 10/34 (29%) | ||
Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 120..129 | CDD:409353 | 3/9 (33%) | ||
FR4 | 122..129 | CDD:409353 | 2/7 (29%) | ||
Ig strand A | 132..137 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 134..199 | CDD:404760 | 29/80 (36%) | ||
Ig strand A' | 140..145 | CDD:409353 | 2/4 (50%) | ||
Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 163..167 | CDD:409353 | 2/3 (67%) | ||
Ig strand D | 174..177 | CDD:409353 | 0/9 (0%) | ||
Ig strand E | 178..183 | CDD:409353 | 2/4 (50%) | ||
Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 217..295 | CDD:404760 | 21/85 (25%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 2/8 (25%) | ||
Ig strand B | 234..238 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I12107 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 142 | 1.000 | Inparanoid score | I4449 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm8732 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
8 | 7.870 |