DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and CADM4

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_660339.1 Gene:CADM4 / 199731 HGNCID:30825 Length:388 Species:Homo sapiens


Alignment Length:361 Identity:80/361 - (22%)
Similarity:130/361 - (36%) Gaps:81/361 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RNFQFTSCDRNGKMLIHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRVG 74
            |.||:.           |||:.:.....||.|....|   ||:||.|..|..||.:....|    
Human     5 RRFQWP-----------LLLLWAAAAGPGAGQEVQTE---NVTVAEGGVAEITCRLHQYDG---- 51

  Fly    75 WLKADTKAIQAIHENVITHNP----------------RVTVSHLDQNTWNLHIKAVSEEDRGGYM 123
                         ..|:..||                |..:.........:.:.....||.|||.
Human    52 -------------SIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYF 103

  Fly   124 CQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRA-RGYPEPIVTWRREDGNEI 187
            |||.|:....||..|.|::.|:....:.....:  ||..|.|:|.. |..|...:.|.| |..|:
Human   104 CQLYTEDTHHQIATLTVLVAPENPVVEVREQAV--EGGEVELSCLVPRSRPAATLRWYR-DRKEL 165

  Fly   188 ----VLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASN-GVPPSVSKRIS--LSIHFHPV 245
                ..::|....::|.:.|..|.:     :::.|..:|.|.| .:|...||:..  |.:.:.|.
Human   166 KGVSSSQENGKVWSVASTVRFRVDR-----KDDGGIIICEAQNQALPSGHSKQTQYVLDVQYSPT 225

  Fly   246 IQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVR 310
            .::.........|..:.:.|.|..:|:        ..::....|...:.|.::::.||   :.:.
Human   226 ARIHASQAVVREGDTLVLTCAVTGNPR--------PNQIRWNRGNESLPERAEAVGET---LTLP 279

  Fly   311 KFQKDDVGSYRCIAKNSLGEVDSSIRLYEI----PG 342
            .....|.|:|.|.|.|..|...:   ||.:    ||
Human   280 GLVSADNGTYTCEASNKHGHARA---LYVLVVYDPG 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 21/95 (22%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 0/3 (0%)
Ig strand E 103..111 CDD:409353 0/7 (0%)
Ig 152..240 CDD:472250 23/95 (24%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 1/4 (25%)
Ig strand G 233..236 CDD:409275 2/2 (100%)
Ig 244..337 CDD:472250 16/92 (17%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
CADM4NP_660339.1 Ig 29..120 CDD:472250 26/110 (24%)
Ig strand B 40..44 CDD:409353 1/3 (33%)
Ig strand C 53..57 CDD:409353 1/3 (33%)
Ig strand E 87..91 CDD:409353 0/3 (0%)
Ig strand F 101..106 CDD:409353 3/4 (75%)
Ig strand G 113..116 CDD:409353 1/2 (50%)
IgI_2_Necl-4 121..220 CDD:409468 24/106 (23%)
Ig strand A 121..124 CDD:409468 0/2 (0%)
Ig strand A' 127..131 CDD:409468 0/3 (0%)
Ig strand B 139..149 CDD:409468 3/9 (33%)
Ig strand C 152..161 CDD:409468 3/9 (33%)
Ig strand C' 162..165 CDD:409468 0/2 (0%)
Ig strand D 167..174 CDD:409468 0/6 (0%)
Ig strand E 177..187 CDD:409468 2/9 (22%)
Ig strand F 195..203 CDD:409468 3/7 (43%)
Ig strand G 212..219 CDD:409468 1/6 (17%)
Ig_3 224..295 CDD:464046 14/81 (17%)
4.1m 344..362 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.