DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and zig-3

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:204 Identity:52/204 - (25%)
Similarity:88/204 - (43%) Gaps:30/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 DVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIV--LKDNVGTKTL---APSFRGEVL----KL 209
            |..|..|.||.|.|.....|..::.|.: ||..|.  .:.||..|.|   .|:....::    ::
 Worm    52 DNTVSTGESVTLRCDVLSTPTGVIYWEK-DGQRIQGDKELNVFEKVLNAMGPTVESGIITSSYQI 115

  Fly   210 SKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAP---LGTDVQIECHVEA-- 269
            ...:.:.:|||.|:|:|| ..:|.....:|:. ...::..:....||   :.|:.:.|....|  
 Worm   116 PCANLHHIGSYKCVATNG-HDTVESSAKISV
E-GQTVKCKSTRRSAPVITMSTESRFELQDNAAT 178

  Fly   270 ----SPKSINY-WIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLG 329
                :.:..|: |:.:..::...||:|.:..|.        .:::||.|..|:|||.|||.|..|
 Worm   179 LICRADRRANWNWMFEDKKIDFDSGRYELLPSG--------DLLIRKIQWSDMGSYFCIAHNKYG 235

  Fly   330 EVDSSIRLY 338
            |......||
 Worm   236 ESRGETFLY 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653
Ig 51..131 CDD:299845
I-set 144..240 CDD:254352 25/94 (27%)
IGc2 159..228 CDD:197706 21/77 (27%)
Ig 244..337 CDD:299845 24/102 (24%)
I-set 244..337 CDD:254352 24/102 (24%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 25/94 (27%)
Ig 61..142 CDD:143165 21/82 (26%)
IG_like 177..244 CDD:214653 19/74 (26%)
Ig <191..237 CDD:299845 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.