DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and rig-3

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:358 Identity:65/358 - (18%)
Similarity:109/358 - (30%) Gaps:140/358 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYP 173
            |.:.|||..|          .|..::..  .:||..:.:..||:: :.|.||..:.::|.... .
 Worm    16 LFVSAVSASD----------SPSSNEAN--PIVISSEAMDYDTNT-ITVREGKKLMVSCVFES-D 66

  Fly   174 EPI----VTWRREDGNEI----------VLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIA 224
            |.|    :.|::.:||.|          |:.:..|:|     .|...|..|.:...:.|.|.|..
 Worm    67 EQIHKSDLLWKQANGNNIDGESNPSLFSVILNEKGSK-----HRKTSLHFSSVHTRDTGLYTCTG 126

  Fly   225 SNGVPPSVSKRISLSIHFHPVIQVPNQ--LVGAPLGTDVQIECHVE---------------ASPK 272
            ......:..|.|.|.:  .|.|:..::  :.||.||..:.|:|.|:               ..|.
 Worm   127 RTAGGENFEKTIKLVV--LPAIEWNDKDTVKGALLGEPITIDCGVKGPSGKEPMIQMTNGNGEPL 189

  Fly   273 SINYWI-----------------------------------------KDTGEMIVTSGKYHVQES 296
            ....|.                                         ||....:.|..::..:||
 Worm   190 DEEIWTIAGNEATIDSLKKEHAELTVSCITIEMHQETSKEEFPVVDRKDVNIEVYTLPEFETEES 254

  Fly   297 SQ---------------------------SMY----ETKMS----------------MIVRKFQK 314
            .|                           :.|    |.|||                :.:....:
 Worm   255 VQYTVIDNHVRDAIIYCNVTHSFPPVRHYTFYHGDEEIKMSDKFNIFVNVGVSQGAHLKIHNVNE 319

  Fly   315 DDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNK 347
            :|:|:|:|.|.|...:...:|.|.|...|...|
 Worm   320 NDLGTYKCEANNIKAKSYHTIHLREANAPAEPK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 5/19 (26%)
Ig 51..131 CDD:299845 5/21 (24%)
I-set 144..240 CDD:254352 24/109 (22%)
IGc2 159..228 CDD:197706 18/82 (22%)
Ig 244..337 CDD:299845 29/197 (15%)
I-set 244..337 CDD:254352 29/197 (15%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653 22/100 (22%)
Ig 267..341 CDD:319273 11/73 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.