DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and igcm-2

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001362087.1 Gene:igcm-2 / 180913 WormBaseID:WBGene00020130 Length:802 Species:Caenorhabditis elegans


Alignment Length:276 Identity:75/276 - (27%)
Similarity:116/276 - (42%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 IKAVSEEDRGGYMCQLN------TDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTCRA 169
            |.:|::.|.|.|.|.:.      |.|.|.....|.|.:||..||...::.:....|:.:...|:|
 Worm    85 IHSVTDGDAGVYQCIVT
KFSKQPTRPEKGLSAKLVVNVPPVIISPSKNAIIHKKVGADLIFECKA 149

  Fly   170 RGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSK 234
            .|.|.|.:||.|   ||.::..:            .||.||.:...:.|.|.|:|.|....|.| 
 Worm   150 EGAPSPEITWSR---NEQIISTS------------PVLTLSNLEEGDKGLYTCLAVNIEGNSTS- 198

  Fly   235 RISLSIHFHPVIQVPNQLVGAPL------GTDVQIECHVEASPKSINY-WIKDTGEMIVTS-G-K 290
              |:.:.|.....:  .|:  ||      |::|...||..|...:|:| |:.:...:..|| | :
 Worm   199 --SI
DVRFTKATIL--DLI--PLNKTVIEGSNVFWHCHANAQATAISYSWLFEKKPIKTTSLGLR 257

  Fly   291 YHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSS---IRLYEIPGPNRNKNPLNG 352
            .:::....|:.:.:         |.|.|.|.|.||||.||..||   :.::..|.|..:..|:..
 Worm   258 SNIRSGDLSLQDVR---------KSDSGWYTCEAKNSAGETTSSTAYLHVFYPPEPLSSHQPVQT 313

  Fly   353 GGKGGGAGGSLDADAN 368
            ...|.....|.|..||
 Worm   314 VASGRNTTVSCDVIAN 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 6/23 (26%)
Ig 51..131 CDD:299845 7/25 (28%)
I-set 144..240 CDD:254352 26/95 (27%)
IGc2 159..228 CDD:197706 20/68 (29%)
Ig 244..337 CDD:299845 28/104 (27%)
I-set 244..337 CDD:254352 28/104 (27%)
igcm-2NP_001362087.1 IG_like 23..101 CDD:214653 6/15 (40%)
Ig 124..200 CDD:386229 25/93 (27%)
IG_like 214..298 CDD:214653 27/92 (29%)
Ig_3 309..371 CDD:372822 6/21 (29%)
Ig 389..467 CDD:386229
FN3 476..548 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.