DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Ncam1

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:328 Identity:78/328 - (23%)
Similarity:118/328 - (35%) Gaps:77/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GRDATFTCHV----------RHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWNLH 110
            |.||...|.|          :|.|  |...||.|.:.|      |:::|             .|.
Mouse   132 GEDAVIVCDVVSSLPPTIIWKHKG--RDVILKKDVRFI------VLSNN-------------YLQ 175

  Fly   111 IKAVSEEDRGGYMCQLNTDPMKSQIGFLD----VVIPPDFISEDTSSDVIVPEGSSVRLTCRARG 171
            |:.:.:.|.|.|.|: .....:.:|.|.|    |.:||...:..:..:.....|.||.|.|.|.|
Mouse   176 IRGIKKTDEGTYRCE-G
RILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADG 239

  Fly   172 YPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRI 236
            :|||.::|.: ||..|..::....|.:......| |.:..:.:|:...|:|||.|..... ...|
Mouse   240 FPEPTMSWTK-DGEPIENEEEDDEKHIFSDDSSE-LTIRNVDKNDEAEYVCIAENKAGEQ-DASI 301

  Fly   237 SLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDT-------------------- 281
            .|.:...|.|..........|...|.:.|.....|.....|...|                    
Mouse   302 HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETL 366

  Fly   282 -GEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLY-----EI 340
             |.|:|.|   |.:.|         |:.::..|..|.|.|.|.|.|::|:...|:.|.     ::
Mouse   367 DGHMVVRS---HARVS---------SLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKL 419

  Fly   341 PGP 343
            .||
Mouse   420 QGP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 20/82 (24%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 1/7 (14%)
Ig 152..240 CDD:472250 25/87 (29%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 2/3 (67%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 24/113 (21%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 1/3 (33%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
Ncam1XP_006510118.1 IgI_1_NCAM-1 20..116 CDD:409451
Ig strand A 20..25 CDD:409451
Ig strand A' 28..32 CDD:409451
Ig strand B 34..44 CDD:409451
Ig strand C 50..56 CDD:409451
Ig strand C' 59..61 CDD:409451
Ig strand D 69..75 CDD:409451
Ig strand E 77..85 CDD:409451
Ig strand F 92..100 CDD:409451
Ig strand G 104..115 CDD:409451
IG_like 124..190 CDD:214653 19/78 (24%)
Ig strand B 135..139 CDD:409353 1/3 (33%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 2/16 (13%)
Ig strand F 186..191 CDD:409353 2/5 (40%)
IgI_3_NCAM-1 211..308 CDD:143207 27/99 (27%)
Ig strand A 211..216 CDD:143207 2/4 (50%)
Ig strand A' 220..226 CDD:143207 0/5 (0%)
Ig strand B 229..239 CDD:143207 5/9 (56%)
Ig strand C 243..249 CDD:143207 2/5 (40%)
Ig strand C' 251..253 CDD:143207 1/1 (100%)
Ig strand D 263..266 CDD:143207 1/2 (50%)
Ig strand E 271..277 CDD:143207 2/6 (33%)
Ig strand F 283..292 CDD:143207 4/8 (50%)
Ig strand G 295..307 CDD:143207 2/12 (17%)
IgI_NCAM-1 307..413 CDD:143277 25/117 (21%)
Ig strand A 307..312 CDD:143277 1/4 (25%)
Ig strand A' 316..320 CDD:143277 0/3 (0%)
Ig strand B 325..333 CDD:143277 2/7 (29%)
Ig strand C 339..345 CDD:143277 1/5 (20%)
Ig strand C' 348..351 CDD:143277 0/2 (0%)
Ig strand D 369..375 CDD:143277 3/8 (38%)
Ig strand E 378..384 CDD:143277 2/14 (14%)
Ig strand F 392..400 CDD:143277 4/7 (57%)
Ig strand G 403..413 CDD:143277 3/9 (33%)
IG_like 422..500 CDD:214653 1/1 (100%)
Ig strand B 433..437 CDD:409353
Ig strand C 446..450 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
fn3 512..599 CDD:394996
fn3 649..731 CDD:394996
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.