| Sequence 1: | NP_726871.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006510118.1 | Gene: | Ncam1 / 17967 | MGIID: | 97281 | Length: | 1162 | Species: | Mus musculus |
| Alignment Length: | 328 | Identity: | 78/328 - (23%) |
|---|---|---|---|
| Similarity: | 118/328 - (35%) | Gaps: | 77/328 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 56 GRDATFTCHV----------RHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWNLH 110
Fly 111 IKAVSEEDRGGYMCQLNTDPMKSQIGFLD----VVIPPDFISEDTSSDVIVPEGSSVRLTCRARG 171
Fly 172 YPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRI 236
Fly 237 SLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDT-------------------- 281
Fly 282 -GEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLY-----EI 340
Fly 341 PGP 343 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-alpha | NP_726871.1 | IG_like | 49..129 | CDD:214653 | 20/82 (24%) |
| Ig strand B | 59..63 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 72..76 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 103..111 | CDD:409353 | 1/7 (14%) | ||
| Ig | 152..240 | CDD:472250 | 25/87 (29%) | ||
| Ig strand B | 163..167 | CDD:409275 | 2/3 (67%) | ||
| Ig strand C | 176..180 | CDD:409275 | 0/3 (0%) | ||
| Ig strand E | 205..209 | CDD:409275 | 2/3 (67%) | ||
| Ig strand F | 219..224 | CDD:409275 | 2/4 (50%) | ||
| Ig strand G | 233..236 | CDD:409275 | 0/2 (0%) | ||
| Ig | 244..337 | CDD:472250 | 24/113 (21%) | ||
| Ig strand B | 261..265 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 274..278 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 305..309 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 319..324 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 332..335 | CDD:409353 | 0/2 (0%) | ||
| Ncam1 | XP_006510118.1 | IgI_1_NCAM-1 | 20..116 | CDD:409451 | |
| Ig strand A | 20..25 | CDD:409451 | |||
| Ig strand A' | 28..32 | CDD:409451 | |||
| Ig strand B | 34..44 | CDD:409451 | |||
| Ig strand C | 50..56 | CDD:409451 | |||
| Ig strand C' | 59..61 | CDD:409451 | |||
| Ig strand D | 69..75 | CDD:409451 | |||
| Ig strand E | 77..85 | CDD:409451 | |||
| Ig strand F | 92..100 | CDD:409451 | |||
| Ig strand G | 104..115 | CDD:409451 | |||
| IG_like | 124..190 | CDD:214653 | 19/78 (24%) | ||
| Ig strand B | 135..139 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 148..152 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 172..176 | CDD:409353 | 2/16 (13%) | ||
| Ig strand F | 186..191 | CDD:409353 | 2/5 (40%) | ||
| IgI_3_NCAM-1 | 211..308 | CDD:143207 | 27/99 (27%) | ||
| Ig strand A | 211..216 | CDD:143207 | 2/4 (50%) | ||
| Ig strand A' | 220..226 | CDD:143207 | 0/5 (0%) | ||
| Ig strand B | 229..239 | CDD:143207 | 5/9 (56%) | ||
| Ig strand C | 243..249 | CDD:143207 | 2/5 (40%) | ||
| Ig strand C' | 251..253 | CDD:143207 | 1/1 (100%) | ||
| Ig strand D | 263..266 | CDD:143207 | 1/2 (50%) | ||
| Ig strand E | 271..277 | CDD:143207 | 2/6 (33%) | ||
| Ig strand F | 283..292 | CDD:143207 | 4/8 (50%) | ||
| Ig strand G | 295..307 | CDD:143207 | 2/12 (17%) | ||
| IgI_NCAM-1 | 307..413 | CDD:143277 | 25/117 (21%) | ||
| Ig strand A | 307..312 | CDD:143277 | 1/4 (25%) | ||
| Ig strand A' | 316..320 | CDD:143277 | 0/3 (0%) | ||
| Ig strand B | 325..333 | CDD:143277 | 2/7 (29%) | ||
| Ig strand C | 339..345 | CDD:143277 | 1/5 (20%) | ||
| Ig strand C' | 348..351 | CDD:143277 | 0/2 (0%) | ||
| Ig strand D | 369..375 | CDD:143277 | 3/8 (38%) | ||
| Ig strand E | 378..384 | CDD:143277 | 2/14 (14%) | ||
| Ig strand F | 392..400 | CDD:143277 | 4/7 (57%) | ||
| Ig strand G | 403..413 | CDD:143277 | 3/9 (33%) | ||
| IG_like | 422..500 | CDD:214653 | 1/1 (100%) | ||
| Ig strand B | 433..437 | CDD:409353 | |||
| Ig strand C | 446..450 | CDD:409353 | |||
| Ig strand E | 473..477 | CDD:409353 | |||
| Ig strand F | 487..492 | CDD:409353 | |||
| fn3 | 512..599 | CDD:394996 | |||
| fn3 | 649..731 | CDD:394996 | |||
| PHA03247 | <905..1140 | CDD:223021 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||