DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and zig-8

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:193 Identity:47/193 - (24%)
Similarity:78/193 - (40%) Gaps:18/193 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VESISN--VSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTW 107
            ||:.|.  |:|.....|...|.|.....:.:.|.:....|:........|.:||..||....|.|
 Worm    37 VENPSQTIVNVVAENPAYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSKKSANIW 101

  Fly   108 NLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIP----PDFISEDTSSDVIVPEGSSVRLTC- 167
            .|:::...::|.|.|:|::|.........:|.|:.|    |..:.:.::..:....|..|.|.| 
 Worm   102 VLNLRRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPPLPSPSSLQKKSTKLMANMSGDEVVLNCT 166

  Fly   168 -RARGYPEPI--VTWRREDGNEIVLKDNVGTKTLAPSFRG-----EVLKLSKISRNEMGSYLC 222
             .:....|.:  |.|.| |||.|...|.  .|.:....|.     |.:::.|.:..:.|:|.|
 Worm   167 VTSTDKDEEVLDVVWTR-DGNTINFNDT--EKYILKVKRDAGVVIETMRIRKATMEDDGNYAC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 21/81 (26%)
Ig 51..131 CDD:299845 20/79 (25%)
I-set 144..240 CDD:254352 21/88 (24%)
IGc2 159..228 CDD:197706 20/73 (27%)
Ig 244..337 CDD:299845
I-set 244..337 CDD:254352
zig-8NP_499714.1 IG_like 55..134 CDD:214653 18/78 (23%)
Ig 55..129 CDD:143165 17/73 (23%)
ig 158..229 CDD:278476 20/72 (28%)
IG_like 158..227 CDD:214653 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.