DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and rig-5

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:419 Identity:139/419 - (33%)
Similarity:202/419 - (48%) Gaps:43/419 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KMLIHLLLIVSLL---EAIGAFQPEFVE--SISNVSVAVGRDATFTCHVRHLGGYRVGWLKADT- 80
            ||.:..||...||   :|.....|..::  |:|:....:|:|..|||.|..||.:.|.::|||: 
 Worm    60 KMYLFALLCGVLLVFKQACSRGAPPTIQQPSMSSAVALLGQDVDFTCIVNDLGSHMVAFVKADSP 124

  Fly    81 KAIQAIHENVITH------NPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLD 139
            ..:.:..|.|...      .||:...|   |.|.|.||.|.|.|||.|.||:||:|:....|.||
 Worm   125 PRLLSFDEKVFRRRNKYELKPRIGDLH---NEWVLTIKNVQESDRGNYSCQINTEPITLSTGELD 186

  Fly   140 VVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRG 204
            |.:|| .:|..|.:.|.|.||::|.|||:|.|.|.|.|.|||:|..  :::.|..|...|..|.|
 Worm   187 VKVPP-VVSRSTPAAVEVREGNNVSLTCKADGNPTPTVIWRRQDRQ--IIRYNGATGFGASVFHG 248

  Fly   205 EVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEA 269
            .||.|:|:||..|..|||:||||:||..|..:.|.:.|.|::|..::.|.|.:|:..::.|..||
 Worm   249 PVLHLTKVSRKHMSEYLCVASNGIPPDESWTVKLLVTFPPLVQAQSETVQASVGSMARMVCTTEA 313

  Fly   270 SPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSS 334
            .|:....|.|| ||.:..|....:..:....|.:...:.:|..|....|.|||:|||..|...|.
 Worm   314 WPRPEMGWEKD-GEPVYESNNVAMTHTVSGQYHSVHILEIRNVQSSHFGVYRCVAKNDNGIHHSQ 377

  Fly   335 IRLYEIPGPNRNKNPLNGGGKGGGAGGSLDADANDILKQKQQVKVTYQPEDEELQYGSVEDFEAE 399
            :.|.:|...:...:.|...|.|...|.|.|.:|::              |::.|: ....|.|.|
 Worm   378 VTLNQISHNHFTNSNLIPEGSGMPRGYSEDDEADE--------------EEDNLE-NQKNDSEEE 427

  Fly   400 GGEGGGLTPLSPHVY-----YTSGNKPAT 423
            ..:    :|.....|     :.|.|.|.|
 Worm   428 DSQ----SPPQLEFYSQARRHESRNAPTT 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 32/86 (37%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 3/7 (43%)
Ig 152..240 CDD:472250 40/87 (46%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 1/3 (33%)
Ig strand E 205..209 CDD:409275 2/3 (67%)
Ig strand F 219..224 CDD:409275 3/4 (75%)
Ig strand G 233..236 CDD:409275 1/2 (50%)
Ig 244..337 CDD:472250 27/92 (29%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 3/4 (75%)
Ig strand G 332..335 CDD:409353 1/2 (50%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 38/99 (38%)
Ig strand B 102..106 CDD:409353 1/3 (33%)
Ig strand C 118..122 CDD:409353 1/3 (33%)
Ig strand E 154..158 CDD:409353 2/3 (67%)
Ig strand F 168..173 CDD:409353 2/4 (50%)
Ig_3 190..270 CDD:464046 37/82 (45%)
Ig_3 287..369 CDD:464046 23/82 (28%)

Return to query results.
Submit another query.