DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and Opcml

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:342 Identity:97/342 - (28%)
Similarity:155/342 - (45%) Gaps:36/342 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHEN 89
            :.||.:|.....:.:....|.:::.||:|..|..||..|.:.. ...||.||...|  |.....:
  Rat    19 LRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDD-RVTRVAWLNRST--ILYAGND 80

  Fly    90 VITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTS 152
            ..:.:|||.:.......:::.|:.|...|.|.|.|.:.||  |..|:: .|.|.:||..:  :.|
  Rat    81 KWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRV-HLIVQVPPQIM--NIS 142

  Fly   153 SDVIVPEGSSVRLTCRARGYPEPIVTWRR---EDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISR 214
            ||:.|.|||||.|.|.|.|.|||.||||.   ::|...|.:|             |.|::|.|.|
  Rat   143 SDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSED-------------EYLEISDIKR 194

  Fly   215 NEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIK 279
            ::.|.|.|.|.|.|.....:::.:::::.|.|..... .|..:|....:.|...|.|.:...|.|
  Rat   195 DQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKN-TGVSVGQKGILSCEASAVPMAEFQWFK 258

  Fly   280 DTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEI---- 340
            :  :..:.:|...|:..::....|   :......:.|.|:|.|:|.|.||..::||.||||    
  Rat   259 E--DTRLATGLDGVRIENKGRIST---LTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSS 318

  Fly   341 --PGPNRNKNPLNGGGK 355
              .||....:.:|...:
  Rat   319 AVAGPGAVIDGVNSASR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 22/79 (28%)
Ig 51..131 CDD:299845 23/81 (28%)
I-set 144..240 CDD:254352 35/98 (36%)
IGc2 159..228 CDD:197706 29/71 (41%)
Ig 244..337 CDD:299845 22/92 (24%)
I-set 244..337 CDD:254352 22/92 (24%)
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 27/91 (30%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/4 (0%)
FR2 64..70 CDD:409353 3/5 (60%)
Ig strand C 64..70 CDD:409353 3/5 (60%)
CDR2 71..83 CDD:409353 2/13 (15%)
Ig strand C' 72..76 CDD:409353 2/5 (40%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 9/33 (27%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 2/3 (67%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 2/7 (29%)
Ig_3 135..206 CDD:404760 34/85 (40%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 5/8 (63%)
Ig strand C 165..170 CDD:409353 3/4 (75%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig_3 223..300 CDD:404760 17/82 (21%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/6 (17%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I11853
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.