DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and ncam1b

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_009289824.1 Gene:ncam1b / 114442 ZFINID:ZDB-GENE-010822-2 Length:1054 Species:Danio rerio


Alignment Length:454 Identity:94/454 - (20%)
Similarity:156/454 - (34%) Gaps:102/454 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSCDRNGKMLIHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKAD 79
            :|.|::.:..::|.:...:.........||.|         |.:|...|.|.......|.|....
Zfish    97 SSGDQDAEATVNLKIYQKITFTNVPSPQEFTE---------GDNAIIVCDVISSPPPTVLWKYKG 152

  Fly    80 TKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGF--LDVVI 142
            .|         |..:..|....|..|  :|.|:.:.:.|.|.|.|: .....:.::.|  :.||:
Zfish   153 AK---------IQFDKDVRFKTLSNN--HLQIRGIRKTDEGVYTCE-GRIKARGEVDFRSIKVVV 205

  Fly   143 P--PDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRR-----EDGNEIVLKDNVGTKTLAP 200
            .  |........::.....|.|..|.|...|:|||||||||     |.||:....::....|   
Zfish   206 NVLPTIRIRQAETNATADMGFSTLLACDPDGFPEPIVTWRRNNAPLESGNKYSFNEDGSEMT--- 267

  Fly   201 SFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIEC 265
                 ||.::|:   :.|.|.|||.|....| .:.:||.:...|.|..........:...|.:.|
Zfish   268 -----VLDVTKL---DEGDYTCIAKNKAGES-EQELSLKVFVQPKITYLESQTTTEMDEQVTLTC 323

  Fly   266 HVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMY---------------------ETKMSMIV 309
            .....|.....|  ..|..:.|.|:   ||..:.:|                     :.::|.:.
Zfish   324 EATGDPTPTITW--SFGTRVFTEGE---QEQQKRIYQASWTRPEQHKGPDGEVLVRSDARVSSLT 383

  Fly   310 RKF-QKDDVGSYRCIAKNSLGE--------------VDSSIRLYEIPGPNRNKNPLNGGGKGGGA 359
            .|: |..|.|.|.|.|:|::||              :..|:.:|...|     ||.|        
Zfish   384 LKYPQYTDAGQYLCTARNAIGETVQPVSLEVRYAPKILGSVAVYTWEG-----NPAN-------- 435

  Fly   360 GGSLDADANDILKQKQQVKVTYQPEDEELQYGSVEDFEAEGGEGGGLTPLSPHVYYTSGNKPAT 423
                  .:.::|.....|.:|:..:..:|...:..:.:...........::|......||...|
Zfish   436 ------ISCEVLAHPSDVSITWLRDGFQLPNANTSNIKIHNTPSASYLEVNPESQSDFGNYNCT 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 17/79 (22%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 2/7 (29%)
Ig 152..240 CDD:472250 30/92 (33%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 3/3 (100%)
Ig strand E 205..209 CDD:409275 2/3 (67%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 24/128 (19%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 1/3 (33%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
ncam1bXP_009289824.1 Ig 20..113 CDD:472250 3/15 (20%)
Ig strand B 37..41 CDD:409353
Ig strand C 49..53 CDD:409353
Ig strand E 77..81 CDD:409353
Ig strand F 91..96 CDD:409353
Ig strand G 104..107 CDD:409353 0/2 (0%)
Ig 117..186 CDD:472250 19/88 (22%)
Ig strand B 132..136 CDD:409353 1/3 (33%)
Ig strand C 145..149 CDD:409353 1/3 (33%)
Ig strand E 169..173 CDD:409353 2/5 (40%)
Ig strand F 183..188 CDD:409353 2/5 (40%)
Ig strand G 198..201 CDD:409353 1/2 (50%)
Ig 208..301 CDD:472250 31/104 (30%)
Ig strand B 228..232 CDD:409353 1/3 (33%)
Ig strand C 241..245 CDD:409353 3/3 (100%)
Ig strand E 264..268 CDD:409353 1/11 (9%)
Ig strand F 278..283 CDD:409353 2/4 (50%)
Ig strand G 291..294 CDD:409353 0/2 (0%)
Ig 300..414 CDD:472250 23/118 (19%)
Ig strand B 319..323 CDD:409353 1/3 (33%)
Ig strand C 332..336 CDD:409353 1/5 (20%)
Ig strand E 380..384 CDD:409353 1/3 (33%)
Ig strand F 394..399 CDD:409353 2/4 (50%)
Ig strand G 407..410 CDD:409353 0/2 (0%)
IG_like 426..505 CDD:214653 13/87 (15%)
Ig strand B 434..438 CDD:409353 1/17 (6%)
Ig strand C 448..452 CDD:409353 1/3 (33%)
Ig strand E 475..479 CDD:409353 0/3 (0%)
Ig strand F 489..494 CDD:409353 2/5 (40%)
FN3 513..606 CDD:238020
fn3 642..712 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.