DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and ncam2

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_571905.1 Gene:ncam2 / 114441 ZFINID:ZDB-GENE-010822-1 Length:795 Species:Danio rerio


Alignment Length:358 Identity:88/358 - (24%)
Similarity:137/358 - (38%) Gaps:73/358 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 MLIHLLLIVSLLEAIGAFQPEFVESIS--NVSVAVGRDATFTCHVRHLG-GYRVGWLKADTKAIQ 84
            |:..:|..:.||  :|..|.....|||  .|.::||....|||.|  :| ..::.|.....:.:.
Zfish     1 MIRTVLCFLGLL--VGGSQGALQVSISLKKVELSVGESKFFTCTV--IGEPVKLEWFNPQGERMV 61

  Fly    85 AIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQ-----------IGFL 138
            |        :|||.: |.:.....|.:.....||.|.|.||......::|           :.|.
Zfish    62 A--------SPRVAL-HNEGIRSRLTLYNAKIEDAGIYRCQATDAQGETQEATVVLEIYQKLTFR 117

  Fly   139 DVVIPPDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTW------RREDGNEIVLKDNVGTKT 197
            ||..|.:|           .:|....:.|.....|.|:|:|      ..||..:..|..|     
Zfish   118 DVRSPQEF-----------RQGEVAEVVCDVTSSPVPVVSWFYNNIEITEDTEKFELLQN----- 166

  Fly   198 LAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVS-KRISLSIHFHPVIQVPNQLVG--APLGT 259
                   ..|::.|:::.:.|.|.|.|.......:. :.|.|.::..||:.||.|...  |..|.
Zfish   167 -------NNLQVQKVTKADEGVYRCEARVEARGEIDFRNIILVVNVPPVVSVPQQSFNATADYGE 224

  Fly   260 DVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETK-MSMIVRKFQKDDVGSYRCI 323
            .|...|....||:....|.:...::         |||.:.:...: .::.||..|:||.|||.|.
Zfish   225 SVTFTCRAYGSPEPDVTWHRKGVQL---------QESERYVMRARGTTLTVRNIQQDDGGSYTCR 280

  Fly   324 AKNSLGEVDSSIRLYEIPGPN----RNKNPLNG 352
            |.|..|||:..:.|.....|:    ||...:.|
Zfish   281 ASNKAGEVEHELFLKVFVQPHITKLRNVTAVEG 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 22/82 (27%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 0/3 (0%)
Ig strand E 103..111 CDD:409353 1/7 (14%)
Ig 152..240 CDD:472250 18/94 (19%)
Ig strand B 163..167 CDD:409275 0/3 (0%)
Ig strand C 176..180 CDD:409275 2/9 (22%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/3 (0%)
Ig 244..337 CDD:472250 29/95 (31%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 3/4 (75%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
ncam2NP_571905.1 IgI_1_NCAM-2 20..112 CDD:409452 25/102 (25%)
Ig strand A 20..25 CDD:409452 1/4 (25%)
Ig strand A' 28..32 CDD:409452 1/3 (33%)
Ig strand B 34..44 CDD:409452 5/11 (45%)
Ig strand C 48..54 CDD:409452 1/5 (20%)
Ig strand C' 57..59 CDD:409452 0/1 (0%)
Ig strand D 65..71 CDD:409452 3/6 (50%)
Ig strand E 73..81 CDD:409452 1/7 (14%)
Ig strand F 88..95 CDD:409452 4/6 (67%)
Ig strand G 100..111 CDD:409452 1/10 (10%)
Ig 131..194 CDD:409353 15/74 (20%)
Ig strand B 131..135 CDD:409353 0/3 (0%)
Ig strand C 144..148 CDD:409353 1/3 (33%)
Ig strand F 181..186 CDD:409353 2/4 (50%)
IgI_1_MuSK 213..296 CDD:409562 26/91 (29%)
Ig strand A' 215..220 CDD:409562 0/4 (0%)
Ig strand B 226..233 CDD:409562 2/6 (33%)
Ig strand C 239..244 CDD:409562 1/4 (25%)
Ig strand C' 246..248 CDD:409562 0/1 (0%)
Ig strand D 255..258 CDD:409562 0/2 (0%)
Ig strand E 262..268 CDD:409562 1/5 (20%)
Ig strand F 275..282 CDD:409562 4/6 (67%)
Ig strand G 288..296 CDD:409562 2/7 (29%)
Ig 298..395 CDD:472250 4/16 (25%)
Ig strand B 316..320 CDD:409353
Ig strand C 329..333 CDD:409353
Ig strand E 361..365 CDD:409353
Ig strand F 375..380 CDD:409353
Ig strand G 388..391 CDD:409353
IG_like 411..488 CDD:214653
Ig strand B 416..420 CDD:409353
Ig strand C 429..433 CDD:409353
Ig strand E 456..460 CDD:409353
Ig strand F 470..475 CDD:409353
FN3 <487..>675 CDD:442628
FN3 494..586 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.