DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and CHL1

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_006605.2 Gene:CHL1 / 10752 HGNCID:1939 Length:1224 Species:Homo sapiens


Alignment Length:384 Identity:81/384 - (21%)
Similarity:147/384 - (38%) Gaps:98/384 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SISNVSVAVGRDATFTCHVRHLGGYRVGWLK--ADTKAIQAIHENVITHNPRVTVSHLDQNTWNL 109
            |.|::::..|......|....|...:|.|.|  .|....:...||.               ...|
Human   262 SESSITILKGEILLLECFAEGLPTPQVDWNKIGGDLPKGRETKENY---------------GKTL 311

  Fly   110 HIKAVSEEDRGGYMCQLNTDPMKSQIGFL-------DVVI--PPDFISEDTSSDVIVPEGSSVRL 165
            .|:.||.:|:|.|.|..:        .||       .|::  ||.:..:..|:  :...||:..|
Human   312 KIENVSYQDKGNYRCTAS--------NFLGTATHDFHVIVEEPPRWTKKPQSA--VYSTGSNGIL 366

  Fly   166 TCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEV-----LKLSKISRNEMGSYLCIAS 225
            .|.|.|.|:|.:.| |.:|:.:   ||       ..|.|:|     :..:.:..|....|.|.||
Human   367 LCEAEGEPQPTIKW-RVNGSPV---DN-------HPFAGDVVFPREISFTNLQPNHTAVYQCEAS 420

  Fly   226 NGVPPSVSKRISLS-IHFHPVIQVPN-QLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTS 288
            | |..::....::. :...|:||..: :.....:|....:.|...|||:::..|.|......:..
Human   421 N-VHGTILANANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEG 484

  Fly   289 GKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLG--------EVDSSIRLYEIPGPNR 345
            .:||:.|:.        ::.:.:..::|.|||.|..:|::|        ::.::.:|...|    
Human   485 RRYHIYENG--------TLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSP---- 537

  Fly   346 NKNP---------LNGGGKGGGAGGSLDADANDILKQKQQVKVTYQPEDEELQYGSVED 395
             |||         |:...|         .|::    .|..:|:::..:.|..:....||
Human   538 -KNPRIPKLHMLELHCESK---------CDSH----LKHSLKLSWSKDGEAFEINGTED 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 18/81 (22%)
Ig 51..131 CDD:299845 17/81 (21%)
I-set 144..240 CDD:254352 25/101 (25%)
IGc2 159..228 CDD:197706 22/73 (30%)
Ig 244..337 CDD:299845 20/101 (20%)
I-set 244..337 CDD:254352 20/101 (20%)
CHL1NP_006605.2 Ig 55..126 CDD:299845
Ig2_L1-CAM_like 129..223 CDD:143253
IG_like 140..224 CDD:214653
IG_like 264..343 CDD:214653 21/101 (21%)
Ig3_L1-CAM_like 274..344 CDD:143208 19/92 (21%)
IG_like 353..434 CDD:214653 24/94 (26%)
Ig4_L1-NrCAM_like 361..435 CDD:143179 23/85 (27%)
IG_like 447..525 CDD:214653 17/85 (20%)
Ig 457..525 CDD:299845 16/75 (21%)
IG_like 548..624 CDD:214653 8/48 (17%)
Ig 548..616 CDD:143165 8/48 (17%)
DGEA 571..574 0/2 (0%)
FN3 628..717 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..732
fn3 731..811 CDD:278470
FN3 834..927 CDD:238020
FN3 932..1027 CDD:238020
Bravo_FIGEY 1120..1205 CDD:290593
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1147..1179
FIG[AQ]Y 1197..1201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1205..1224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.