DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and CHL1

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_006605.2 Gene:CHL1 / 10752 HGNCID:1939 Length:1224 Species:Homo sapiens


Alignment Length:384 Identity:81/384 - (21%)
Similarity:147/384 - (38%) Gaps:98/384 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SISNVSVAVGRDATFTCHVRHLGGYRVGWLK--ADTKAIQAIHENVITHNPRVTVSHLDQNTWNL 109
            |.|::::..|......|....|...:|.|.|  .|....:...||.               ...|
Human   262 SESSITILKGEILLLECFAEGLPTPQVDWNKIGGDLPKGRETKENY---------------GKTL 311

  Fly   110 HIKAVSEEDRGGYMCQLNTDPMKSQIGFL-------DVVI--PPDFISEDTSSDVIVPEGSSVRL 165
            .|:.||.:|:|.|.|..:        .||       .|::  ||.:..:..|:  :...||:..|
Human   312 KIENVSYQDKGNYRCTAS--------NFLGTATHDFHVIVEEPPRWTKKPQSA--VYSTGSNGIL 366

  Fly   166 TCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEV-----LKLSKISRNEMGSYLCIAS 225
            .|.|.|.|:|.:.| |.:|:.:   ||       ..|.|:|     :..:.:..|....|.|.||
Human   367 LCEAEGEPQPTIKW-RVNGSPV---DN-------HPFAGDVVFPREISFTNLQPNHTAVYQCEAS 420

  Fly   226 NGVPPSVSKRISLS-IHFHPVIQVPN-QLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTS 288
            | |..::....::. :...|:||..: :.....:|....:.|...|||:::..|.|......:..
Human   421 N-VHGTILANANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEG 484

  Fly   289 GKYHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLG--------EVDSSIRLYEIPGPNR 345
            .:||:.|:.        ::.:.:..::|.|||.|..:|::|        ::.::.:|...|    
Human   485 RRYHIYENG--------TLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSP---- 537

  Fly   346 NKNP---------LNGGGKGGGAGGSLDADANDILKQKQQVKVTYQPEDEELQYGSVED 395
             |||         |:...|         .|::    .|..:|:::..:.|..:....||
Human   538 -KNPRIPKLHMLELHCESK---------CDSH----LKHSLKLSWSKDGEAFEINGTED 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 18/81 (22%)
Ig strand B 59..63 CDD:409353 0/3 (0%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 1/7 (14%)
Ig 152..240 CDD:472250 24/93 (26%)
Ig strand B 163..167 CDD:409275 1/3 (33%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 1/8 (13%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 20/101 (20%)
Ig strand B 261..265 CDD:409353 0/3 (0%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 3/4 (75%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
CHL1NP_006605.2 Ig 35..126 CDD:472250
Ig strand B 53..57 CDD:409396
Ig strand C 66..70 CDD:409396
Ig strand E 90..94 CDD:409396
Ig strand F 106..111 CDD:409396
Ig strand G 120..123 CDD:409396
IgI_2_L1-CAM_like 135..225 CDD:409432
Ig strand A 135..138 CDD:409432
Ig strand A' 140..144 CDD:409432
Ig strand B 147..155 CDD:409432
Ig strand C 162..168 CDD:409432
Ig strand C' 171..174 CDD:409432
Ig strand D 180..184 CDD:409432
Ig strand E 186..190 CDD:409432
Ig strand F 201..209 CDD:409432
Ig strand G 212..225 CDD:409432
Ig3_L1-CAM_like 262..344 CDD:409394 22/104 (21%)
Ig strand B 274..278 CDD:409394 0/3 (0%)
Ig strand C 287..291 CDD:409394 1/3 (33%)
Ig strand E 309..313 CDD:409394 1/3 (33%)
Ig strand F 323..328 CDD:409394 2/4 (50%)
Ig strand G 336..339 CDD:409394 0/2 (0%)
Ig4_L1-NrCAM_like 348..435 CDD:409367 24/100 (24%)
Ig strand B 364..368 CDD:409367 1/3 (33%)
Ig strand C 377..381 CDD:409367 1/4 (25%)
Ig strand E 400..404 CDD:409367 0/3 (0%)
Ig strand F 414..419 CDD:409367 2/4 (50%)
Ig strand G 427..430 CDD:409367 0/2 (0%)
Ig 448..525 CDD:472250 17/84 (20%)
Ig strand B 457..461 CDD:409390 0/3 (0%)
Ig strand C 470..474 CDD:409390 0/3 (0%)
Ig strand E 493..497 CDD:409390 0/11 (0%)
Ig strand F 507..512 CDD:409390 3/4 (75%)
Ig strand G 520..523 CDD:409390 0/2 (0%)
Ig 548..617 CDD:409353 8/48 (17%)
Ig strand B 548..552 CDD:409353 1/3 (33%)
Ig strand C 565..569 CDD:409353 1/3 (33%)
DGEA 571..574 0/2 (0%)
Ig strand E 590..594 CDD:409353
Ig strand F 604..609 CDD:409353
FN3 <616..>868 CDD:442628
FN3 628..717 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 709..732
FN3 834..927 CDD:238020
FN3 932..1027 CDD:238020
Bravo_FIGEY 1120..1205 CDD:464016
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1147..1179
FIG[AQ]Y 1197..1201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1205..1224
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.