DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and pigrl4.2

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001293038.1 Gene:pigrl4.2 / 105665605 ZFINID:ZDB-GENE-150409-10 Length:240 Species:Danio rerio


Alignment Length:228 Identity:52/228 - (22%)
Similarity:82/228 - (35%) Gaps:44/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 ISEDTSSDVIVPEGSSVRLTCR------------ARGYPEPIVTWRREDGNEIVLKDN-VGTKTL 198
            :|..|...|.|.||.::.:.|.            ..|.     ||.   |..:|...| .|..|:
Zfish    18 LSMKTLDRVPVIEGETITIPCLYDNKYKLNKKYWCNGN-----TWL---GCSVVAYANHTGKWTI 74

  Fly   199 A--PSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDV 261
            .  |......:.|:..:.::.|.|.|..........||.:.|::...|.:.|.:..|....|.||
Zfish    75 TDYPDHNMFTVTLNNSTSSDSGHYWCAVEIDHHVDNSKYLYLTVQKAPDVSVLSSSVSGHKGDDV 139

  Fly   262 QIEC-HVEASPKSINYWI----------KDTGEMIVTSGKYHVQESSQSMYETKMSMIVRKFQKD 315
            .:.| :..|....:..|.          |.|.    ||....||.|...  |:..::::...:..
Zfish   140 SVRCFYRSAYQNKLKQWCRIDDLTCFREKKTD----TSQNSSVQISDDG--ESSFTVLMTGLRLS 198

  Fly   316 DVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKN 348
            |.|.|.|    |:|.:...::|....|.|:|||
Zfish   199 DSGWYFC----SVGNLQVPVQLTVYQGENKNKN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653
Ig 51..131 CDD:299845
I-set 144..240 CDD:254352 23/107 (21%)
IGc2 159..228 CDD:197706 16/83 (19%)
Ig 244..337 CDD:299845 23/103 (22%)
I-set 244..337 CDD:254352 23/103 (22%)
pigrl4.2NP_001293038.1 IG_like 26..118 CDD:214653 21/99 (21%)
Ig_pIgR 30..117 CDD:143193 18/94 (19%)
Ig 133..217 CDD:299845 20/93 (22%)
IG_like 136..218 CDD:214653 21/91 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.