DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and si:ch211-215e19.3

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_002660995.5 Gene:si:ch211-215e19.3 / 100332384 ZFINID:ZDB-GENE-060503-685 Length:280 Species:Danio rerio


Alignment Length:320 Identity:60/320 - (18%)
Similarity:107/320 - (33%) Gaps:92/320 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSCDRNGKMLIHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTC-----HVRHLGGYRVG 74
            ||.|     :|:.|::..:|..||  ...::..: |:.|..|......|     :..|...:..|
Zfish    13 TSAD-----MIYTLILSGVLLHIG--DGVWINKL-NIGVKSGSPGIIPCLYDEQYKEHQKFWCWG 69

  Fly    75 WLKADTKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIG--- 136
            ...:....:..::|   |.|......:..|:.:.:..:.:...|...|.|.:       :||   
Zfish    70 TFFSTCSILAYVNE---TRNKFSITDYPAQSIFTVEWQNLQLSDSSYYWCVV-------EIGGPG 124

  Fly   137 --------FLDVVIPPDFISEDTSSDVIVPEGSSVRLTC-RARGYPEPIVTWRREDGNEIVLKDN 192
                    :|.|...||.  ...:|.|...||.:|.:.| .:.||......|.|........::.
Zfish   125 TLDAGYYLYLTVQSAPDL--SVMNSSVSGHEGGNVSVQCFYSSGYKNKTKQWCRVKDKSCFPENK 187

  Fly   193 VGT---KTLAPSFRGE---VLKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQ 251
            ..|   .::..|..||   .:.::.::.::.|.|.|.|.|                   :|||.|
Zfish   188 TDTFQNSSVQISDDGESCFTVLMTGLTLSDSGWYFCSAGN-------------------LQVPVQ 233

  Fly   252 L-VGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYHVQESSQSMYETKMSMIVR 310
            | |..|             .||.:                |..|.|::.:..|.::.:.|
Zfish   234 LTVTKP-------------EPKDL----------------YTTQPSAKQIPTTVLTTVSR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 13/84 (15%)
Ig 51..131 CDD:299845 12/84 (14%)
I-set 144..240 CDD:254352 21/102 (21%)
IGc2 159..228 CDD:197706 17/75 (23%)
Ig 244..337 CDD:299845 14/68 (21%)
I-set 244..337 CDD:254352 14/68 (21%)
si:ch211-215e19.3XP_002660995.5 Ig 51..122 CDD:325142 11/80 (14%)
Ig 149..235 CDD:325142 22/104 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.