Sequence 1: | NP_001259218.1 | Gene: | DIP-alpha / 31322 | FlyBaseID: | FBgn0052791 | Length: | 554 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
Alignment Length: | 325 | Identity: | 90/325 - (27%) |
---|---|---|---|
Similarity: | 149/325 - (45%) | Gaps: | 55/325 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 SISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVI-------THNPRVTVSHLDQ 104
Fly 105 NTWNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTC 167
Fly 168 RARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFR----GEVLKLSKISRNEMGSYLCIASNGV 228
Fly 229 P-PSVSKRISLSIHFHPVIQ--VPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGK 290
Fly 291 YHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGK 355
Fly 356 355 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-alpha | NP_001259218.1 | IG_like | 49..129 | CDD:214653 | 19/86 (22%) |
Ig | 51..131 | CDD:299845 | 19/88 (22%) | ||
I-set | 144..240 | CDD:254352 | 33/100 (33%) | ||
IGc2 | 159..228 | CDD:197706 | 23/72 (32%) | ||
Ig | 244..337 | CDD:299845 | 27/94 (29%) | ||
I-set | 244..337 | CDD:254352 | 27/94 (29%) | ||
negr1 | XP_031755650.1 | Ig | 44..136 | CDD:416386 | 23/101 (23%) |
FR1 | 44..62 | CDD:409353 | 4/16 (25%) | ||
Ig strand A' | 47..53 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 55..63 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 63..68 | CDD:409353 | 1/5 (20%) | ||
FR2 | 69..75 | CDD:409353 | 2/14 (14%) | ||
Ig strand C | 69..74 | CDD:409353 | 1/4 (25%) | ||
CDR2 | 76..87 | CDD:409353 | 1/10 (10%) | ||
Ig strand C' | 78..82 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
FR3 | 88..122 | CDD:409353 | 10/33 (30%) | ||
Ig strand D | 91..98 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 101..107 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 114..122 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 123..127 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 127..136 | CDD:409353 | 3/9 (33%) | ||
FR4 | 129..136 | CDD:409353 | 2/7 (29%) | ||
Ig_3 | 140..208 | CDD:404760 | 28/85 (33%) | ||
Ig strand A' | 146..151 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 157..164 | CDD:409353 | 3/6 (50%) | ||
Ig strand C | 170..175 | CDD:409353 | 1/4 (25%) | ||
Ig strand C' | 177..179 | CDD:409353 | 0/1 (0%) | ||
Ig strand E | 187..193 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 200..207 | CDD:409353 | 3/6 (50%) | ||
Ig strand G | 214..222 | CDD:409353 | 2/8 (25%) | ||
Ig_3 | 226..302 | CDD:404760 | 23/83 (28%) | ||
putative Ig strand A | 226..232 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 242..246 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 255..259 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 281..285 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 295..300 | CDD:409353 | 2/4 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 58 | 1.000 | Domainoid score | I10578 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 138 | 1.000 | Inparanoid score | I4412 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.060 |