DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and negr1

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:325 Identity:90/325 - (27%)
Similarity:149/325 - (45%) Gaps:55/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVI-------THNPRVTVSHLDQ 104
            ::.|:.|..|..|...|.:.. |..:..||.         ..::|       :.:|||:::...:
 Frog    45 AVDNLVVRQGETAMLRCFLEE-GASKGAWLN---------RSSIIFAGGDKWSVDPRVSIATSSK 99

  Fly   105 NTWNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTC 167
            ..::|.|:.|...|.|.|.|.:.|:  |...|: .|.|.:.|...  |.|||:.|.||::|.|.|
 Frog   100 QEYSLRIQKVDVSDDGPYTCSVQTEHSPRTLQV-HLTVHVSPKIY--DISSDMTVNEGTNVSLIC 161

  Fly   168 RARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFR----GEVLKLSKISRNEMGSYLCIASNGV 228
            .|.|.|||.::||.                ::||.:    |:.|.:..|:|::.|.|.|.|.|.|
 Frog   162 LATGKPEPSISWRH----------------ISPSAKQFGSGQYLDIYGITRDQAGDYECSAENDV 210

  Fly   229 P-PSVSKRISLSIHFHPVIQ--VPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGK 290
            . |.| |::.::::|.|.|.  .|   .|..||....|.|...|.|..:..|.|  ||..:|:|:
 Frog   211 SFPDV-KKVKVTVNFAPTILEITP---TGVSLGRTGLIRCETAAVPAPVFEWYK--GEKKLTNGQ 269

  Fly   291 YHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGK 355
            ..::..:   |.|:..:.|....::..|:|.|:|.|.||..::|:.|.:|..|: ..:|:....|
 Frog   270 RGIRIQN---YNTRSILTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPS-TTSPVTSSAK 330

  Fly   356  355
             Frog   331  330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 19/86 (22%)
Ig 51..131 CDD:299845 19/88 (22%)
I-set 144..240 CDD:254352 33/100 (33%)
IGc2 159..228 CDD:197706 23/72 (32%)
Ig 244..337 CDD:299845 27/94 (29%)
I-set 244..337 CDD:254352 27/94 (29%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 23/101 (23%)
FR1 44..62 CDD:409353 4/16 (25%)
Ig strand A' 47..53 CDD:409353 2/5 (40%)
Ig strand B 55..63 CDD:409353 2/7 (29%)
CDR1 63..68 CDD:409353 1/5 (20%)
FR2 69..75 CDD:409353 2/14 (14%)
Ig strand C 69..74 CDD:409353 1/4 (25%)
CDR2 76..87 CDD:409353 1/10 (10%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 10/33 (30%)
Ig strand D 91..98 CDD:409353 2/6 (33%)
Ig strand E 101..107 CDD:409353 1/5 (20%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 3/9 (33%)
FR4 129..136 CDD:409353 2/7 (29%)
Ig_3 140..208 CDD:404760 28/85 (33%)
Ig strand A' 146..151 CDD:409353 3/4 (75%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 1/4 (25%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 1/5 (20%)
Ig strand F 200..207 CDD:409353 3/6 (50%)
Ig strand G 214..222 CDD:409353 2/8 (25%)
Ig_3 226..302 CDD:404760 23/83 (28%)
putative Ig strand A 226..232 CDD:409353 2/5 (40%)
Ig strand B 242..246 CDD:409353 1/3 (33%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 0/3 (0%)
Ig strand F 295..300 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.