DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and negr1

DIOPT Version :10

Sequence 1:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:325 Identity:90/325 - (27%)
Similarity:149/325 - (45%) Gaps:55/325 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVI-------THNPRVTVSHLDQ 104
            ::.|:.|..|..|...|.:.. |..:..||.         ..::|       :.:|||:::...:
 Frog    45 AVDNLVVRQGETAMLRCFLEE-GASKGAWLN---------RSSIIFAGGDKWSVDPRVSIATSSK 99

  Fly   105 NTWNLHIKAVSEEDRGGYMCQLNTD--PMKSQIGFLDVVIPPDFISEDTSSDVIVPEGSSVRLTC 167
            ..::|.|:.|...|.|.|.|.:.|:  |...|: .|.|.:.|...  |.|||:.|.||::|.|.|
 Frog   100 QEYSLRIQKVDVSDDGPYTCSVQTEHSPRTLQV-HLTVHVSPKIY--DISSDMTVNEGTNVSLIC 161

  Fly   168 RARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFR----GEVLKLSKISRNEMGSYLCIASNGV 228
            .|.|.|||.::||.                ::||.:    |:.|.:..|:|::.|.|.|.|.|.|
 Frog   162 LATGKPEPSISWRH----------------ISPSAKQFGSGQYLDIYGITRDQAGDYECSAENDV 210

  Fly   229 P-PSVSKRISLSIHFHPVIQ--VPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGK 290
            . |.| |::.::::|.|.|.  .|   .|..||....|.|...|.|..:..|.|  ||..:|:|:
 Frog   211 SFPDV-KKVKVTVNFAPTILEITP---TGVSLGRTGLIRCETAAVPAPVFEWYK--GEKKLTNGQ 269

  Fly   291 YHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEIPGPNRNKNPLNGGGK 355
            ..::..:   |.|:..:.|....::..|:|.|:|.|.||..::|:.|.:|..|: ..:|:....|
 Frog   270 RGIRIQN---YNTRSILTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEPS-TTSPVTSSAK 330

  Fly   356  355
             Frog   331  330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 19/86 (22%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 0/3 (0%)
Ig strand E 103..111 CDD:409353 1/7 (14%)
Ig 152..240 CDD:472250 31/92 (34%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 2/4 (50%)
Ig strand G 233..236 CDD:409275 1/2 (50%)
Ig 244..337 CDD:472250 27/94 (29%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 319..324 CDD:409353 2/4 (50%)
Ig strand G 332..335 CDD:409353 0/2 (0%)
negr1XP_031755650.1 Ig 44..136 CDD:472250 23/101 (23%)
Ig strand B 57..61 CDD:409353 1/3 (33%)
Ig strand C 70..73 CDD:409353 0/2 (0%)
Ig strand E 102..106 CDD:409353 1/3 (33%)
Ig strand F 116..121 CDD:409353 2/4 (50%)
Ig strand G 129..132 CDD:409353 0/2 (0%)
Ig 146..222 CDD:472250 31/92 (34%)
Ig strand B 157..161 CDD:409301 2/3 (67%)
Ig strand C 170..174 CDD:409301 0/3 (0%)
Ig strand E 187..191 CDD:409301 1/3 (33%)
Ig strand F 201..206 CDD:409301 2/4 (50%)
Ig strand G 215..218 CDD:409301 2/3 (67%)
Ig_3 226..302 CDD:464046 23/83 (28%)

Return to query results.
Submit another query.