DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and lsamp

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:364 Identity:99/364 - (27%)
Similarity:165/364 - (45%) Gaps:35/364 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSCDRNGKMLIHLLLIVSLLEAIGAFQPEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKAD 79
            :..|||...|:.|.|:..|...:.....:|..|..|::|..|..|...|.|..... ||.||  :
 Frog     5 SQADRNQLPLLLLRLLCLLPTGLPVRSGDFNRSTDNITVRQGDTAILRCFVEDRSS-RVAWL--N 66

  Fly    80 TKAIQAIHENVITHNPRVTVSHLDQNTWNLHIKAVSEEDRGGYMCQLNT-DPMKSQIGFLDVVIP 143
            ...|....::..:.:|||.:.......::|.|:.|...|.|.|.|.:.| ...|:...:|.|.:|
 Frog    67 RSGIIFAGDDKWSLDPRVELEKRSLLEYSLRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLIVQVP 131

  Fly   144 PDFISEDTSSDVIVPEGSSVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRG--EV 206
            |..  .:.|:|:.|.|||:|.|.|.|.|.|||::|||.       |....||.. |..|.|  |.
 Frog   132 PKI--SNISADITVNEGSNVTLMCIAYGRPEPMITWRH-------LTPTAGTSP-ARDFEGEEEF 186

  Fly   207 LKLSKISRNEMGSYLCIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASP 271
            |::..|:|.:.|.|.|.|:|.|..:..|::.:::::.|:| ..::...|..|....:.|...|.|
 Frog   187 LEIQGITREQSGRYECKAANEVASADVKQVRVTVNYPPII-TESKSNEATTGKQAILRCEASAVP 250

  Fly   272 KSINYWIK-DTGEMIVTSGK-YHVQESSQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSS 334
            .....|.| ||....:.|.: ..::.:.     ::..::|....::..|:|.|:|.|.||..::|
 Frog   251 APDFEWYKDDTRSRRINSAQGLEIRNTG-----SRSVLMVANVTEEHYGNYTCVAANKLGITNTS 310

  Fly   335 IRLYEIPGPNRNKNPLNGGGKGG--------GAGGSLDA 365
            :.||:...|.:   |::...:|.        |.|..:|:
 Frog   311 LYLYKRVSPTK---PMSASERGSNVHYQYKVGPGTPIDS 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 22/80 (28%)
Ig 51..131 CDD:299845 21/80 (26%)
I-set 144..240 CDD:254352 35/97 (36%)
IGc2 159..228 CDD:197706 29/70 (41%)
Ig 244..337 CDD:299845 21/94 (22%)
I-set 244..337 CDD:254352 21/94 (22%)
lsampXP_031751462.1 Ig 38..128 CDD:416386 24/92 (26%)
FR1 38..54 CDD:409353 4/15 (27%)
Ig strand A' 39..45 CDD:409353 2/5 (40%)
Ig strand B 47..55 CDD:409353 2/7 (29%)
CDR1 55..59 CDD:409353 1/3 (33%)
FR2 60..67 CDD:409353 4/9 (44%)
Ig strand C 60..66 CDD:409353 4/8 (50%)
CDR2 68..78 CDD:409353 1/9 (11%)
Ig strand C' 70..73 CDD:409353 1/2 (50%)
Ig strand C' 75..78 CDD:409353 0/2 (0%)
FR3 79..114 CDD:409353 10/34 (29%)
Ig strand D 83..90 CDD:409353 2/6 (33%)
Ig strand E 93..99 CDD:409353 1/5 (20%)
Ig strand F 106..114 CDD:409353 3/7 (43%)
CDR3 115..119 CDD:409353 1/3 (33%)
Ig strand G 119..128 CDD:409353 2/8 (25%)
FR4 121..128 CDD:409353 1/6 (17%)
Ig_3 131..206 CDD:404760 33/84 (39%)
Ig strand A' 138..143 CDD:409353 2/4 (50%)
Ig strand B 149..156 CDD:409353 3/6 (50%)
Ig strand C 162..167 CDD:409353 2/4 (50%)
Ig strand C' 173..175 CDD:409353 1/1 (100%)
Ig strand E 185..191 CDD:409353 2/5 (40%)
Ig strand F 198..205 CDD:409353 3/6 (50%)
Ig strand G 212..220 CDD:409353 1/7 (14%)
Ig_3 223..302 CDD:404760 17/84 (20%)
putative Ig strand A 224..230 CDD:409353 2/6 (33%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 0/3 (0%)
Ig strand F 295..300 CDD:409353 2/4 (50%)
Ig strand G 308..311 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.