DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-alpha and dscaml1

DIOPT Version :9

Sequence 1:NP_001259218.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster
Sequence 2:XP_005157551.1 Gene:dscaml1 / 100002762 -ID:- Length:2158 Species:Danio rerio


Alignment Length:478 Identity:115/478 - (24%)
Similarity:176/478 - (36%) Gaps:107/478 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PVSAKRLLRNFQFTSCDRNGKMLIHLLLIVSLLEAIGAFQ--------------------PEFVE 46
            ||:.....|..|:|..|  |..:.|:.:....:...|.::                    |..:.
Zfish   516 PVARDSAHRASQYTLSD--GSTVSHVNVTNPQIRDGGVYRCAARNSAGSAEYQARINVRGPPSIR 578

  Fly    47 SISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQNTWNLHI 111
            ::.|::...||:....|.|.....|.:.|.| |...:...|..|:..|..:.:|.:.:..     
Zfish   579 AMRNITAVAGRNTFINCRVIGYPYYSIKWYK-DGMLLPDNHRQVVYENGTLKLSDVQKGM----- 637

  Fly   112 KAVSEEDRGGYMCQLNTDPMK--SQIGFLDVVIPP-----DFISEDTSSDVIVPEGSSVRLTCRA 169
                  |.|.|:|.:...|..  ||..::.|.:||     ||  ..||.      |..:.:.|..
Zfish   638 ------DEGAYLCSVLIQPQLSISQTVYVTVKVPPLIQPFDF--PPTSI------GKLMYIACVV 688

  Fly   170 RGYPEPI-VTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPPSVS 233
            .....|| :|||: ||.||| ....|.......|... |::||:|....|:|.|||||.. .:||
Zfish   689 SSGDMPIRITWRK-DGQEIV-SGTAGVTIETKEFMSS-LQISKVSLKHNGNYTCIASNDA-ATVS 749

  Fly   234 KRISLSIHFHPVIQV-PNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSGKYH-VQES 296
            ....|.:...|..:| ||...|. .|....:.|.||..|.....|....|  |....:|| |..:
Zfish   750 SERQLIVTVPPRFRVQPNNQDGI-YGKSEVLNCSVEGYPPPKVVWKHAKG--IGNPQQYHPVPLT 811

  Fly   297 SQSMYETKMSMIVRKFQKDDVGSYRCIAKNSLG-EVDSSIRL-YEIPG-----PN-------RNK 347
            .:....:..|:::|...::|.|.|.|.|.|.:| ::..|:.| .:||.     ||       :||
Zfish   812 GRIQILSNGSLLIRHVLEEDRGYYLCQASNGVGSDISKSMMLTVKIPAMITSHPNTTMAIKGQNK 876

  Fly   348 NPLNGGGKG----------GGAGGSLDADANDILKQKQQVKVTYQPEDEE-----------LQYG 391
            . ||...:|          |..  .:|.|.|      .:..:|..|.::.           .:.|
Zfish   877 E-LNCTARGEYPIIIRWERGDT--VIDPDRN------PRYSITTSPNEKSDEVISTLKLKPAERG 932

  Fly   392 SVEDFEAEG----GEGGGLTPLS 410
            ....|....    |||.||..|:
Zfish   933 DSVFFSCHAINSYGEGRGLIQLT 955

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-alphaNP_001259218.1 IG_like 49..129 CDD:214653 17/79 (22%)
Ig 51..131 CDD:299845 16/79 (20%)
I-set 144..240 CDD:254352 33/101 (33%)
IGc2 159..228 CDD:197706 25/69 (36%)
Ig 244..337 CDD:299845 26/95 (27%)
I-set 244..337 CDD:254352 26/95 (27%)
dscaml1XP_005157551.1 IG_like 112..184 CDD:214653
Ig 112..183 CDD:143165
Ig 194..287 CDD:299845
I-set 302..380 CDD:254352
IGc2 309..370 CDD:197706
IGc2 399..458 CDD:197706
I-set 477..571 CDD:254352 9/56 (16%)
Ig 477..567 CDD:299845 9/52 (17%)
IG_like 581..662 CDD:214653 20/92 (22%)
IGc2 588..646 CDD:197706 16/69 (23%)
Ig 684..751 CDD:143165 26/70 (37%)
IG_like 686..756 CDD:214653 27/73 (37%)
I-set 760..855 CDD:254352 27/97 (28%)
Ig7_DSCAM 778..855 CDD:143211 21/78 (27%)
IG_like 865..956 CDD:214653 21/100 (21%)
Ig 873..963 CDD:299845 19/92 (21%)
FN3 959..1053 CDD:238020
FN3 1060..1157 CDD:238020
FN3 1165..1271 CDD:238020
FN3 1276..1367 CDD:238020
IGc2 1392..1455 CDD:197706
FN3 1486..1559 CDD:238020
FN3 1573..1649 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.