DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14270 and TIMM29

DIOPT Version :9

Sequence 1:NP_570063.1 Gene:CG14270 / 31319 FlyBaseID:FBgn0029665 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_612367.1 Gene:TIMM29 / 90580 HGNCID:25152 Length:260 Species:Homo sapiens


Alignment Length:163 Identity:44/163 - (26%)
Similarity:74/163 - (45%) Gaps:13/163 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WVQY--W-NGLVRDYTEVAVGVVRESYTKPKKALLY-----GTGMLFMYQANLKNPGEEAFMTLL 91
            |.:.  | ..|:|||.|.......|:..:|.:|.:|     |....|...     |.|.||...|
Human    28 WARLGSWARALLRDYAEACRDASAEARARPGRAAVYVGLLGGAAACFTLA-----PSEGAFEEAL 87

  Fly    92 RGATNRMITVPVELQNPVSADYLLTLERAINQKKLRLLSLGICTILWVDLYDEDDCTYPAICEYT 156
            ..|:..::.:....:|..|..::..|.....:.:||.::||:|::::...:|.....|.|.|.|.
Human    88 LEASGTLLLLAPATRNRESEAFVQRLLWLRGRGRLRYVNLGLCSLVYEAPFDAQASLYQARCRYL 152

  Fly   157 NVGVFNFHERIIDVGFWNQYWRLKWKMRNYDVN 189
            .....:|..|::||||..::|.|...||:.|:|
Human   153 QPRWTDFPGRVLDVGFVGRWWVLGAWMRDCDIN 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14270NP_570063.1 DUF2366 22..190 CDD:287180 44/163 (27%)
TIMM29NP_612367.1 Tim29 24..186 CDD:401979 44/163 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158962
Domainoid 1 1.000 63 1.000 Domainoid score I10309
eggNOG 1 0.900 - - E1_KOG4545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34702
Inparanoid 1 1.050 62 1.000 Inparanoid score I5379
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49426
OrthoDB 1 1.010 - - D1386679at2759
OrthoFinder 1 1.000 - - FOG0007519
OrthoInspector 1 1.000 - - oto90567
orthoMCL 1 0.900 - - OOG6_108329
Panther 1 1.100 - - LDO PTHR21435
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5853
SonicParanoid 1 1.000 - - X6409
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.