DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14270 and Timm29

DIOPT Version :9

Sequence 1:NP_570063.1 Gene:CG14270 / 31319 FlyBaseID:FBgn0029665 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_848734.1 Gene:Timm29 / 69773 MGIID:1917023 Length:266 Species:Mus musculus


Alignment Length:159 Identity:47/159 - (29%)
Similarity:76/159 - (47%) Gaps:5/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WVQY--WNG-LVRDYTEVAVGVVRESYTKPKKALLYGTGMLFMYQANLK-NPGEEAFMTLLRGAT 95
            |.:.  |.| |:|||.|........:..:|.:|.|| .|:|....|... .|.|.||...|..|:
Mouse    34 WTRLSTWAGALLRDYAEACGDAAAAARARPGRAALY-VGLLGGAAACCALAPSEAAFEEALLDAS 97

  Fly    96 NRMITVPVELQNPVSADYLLTLERAINQKKLRLLSLGICTILWVDLYDEDDCTYPAICEYTNVGV 160
            ..::.:....:|..|..:|..|.....:.:||.::||.|::::...:|.....|.|.|.|.....
Mouse    98 GSLLLLAPATRNRHSEAFLQRLLWLRGRGRLRHVNLGFCSLVYEAPFDAQASLYQARCRYLQPRW 162

  Fly   161 FNFHERIIDVGFWNQYWRLKWKMRNYDVN 189
            .:|..||:||||..::|.|:.:|.:.|:|
Mouse   163 VDFPGRILDVGFVGRWWILQNRMHDCDIN 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14270NP_570063.1 DUF2366 22..190 CDD:287180 47/159 (30%)
Timm29NP_848734.1 DUF2366 30..192 CDD:287180 47/159 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849342
Domainoid 1 1.000 65 1.000 Domainoid score I10065
eggNOG 1 0.900 - - E1_KOG4545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34702
Inparanoid 1 1.050 64 1.000 Inparanoid score I5362
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49426
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007519
OrthoInspector 1 1.000 - - oto94158
orthoMCL 1 0.900 - - OOG6_108329
Panther 1 1.100 - - LDO PTHR21435
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5853
SonicParanoid 1 1.000 - - X6409
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.