DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14270 and timm29

DIOPT Version :9

Sequence 1:NP_570063.1 Gene:CG14270 / 31319 FlyBaseID:FBgn0029665 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001018397.1 Gene:timm29 / 553583 ZFINID:ZDB-GENE-050522-380 Length:252 Species:Danio rerio


Alignment Length:171 Identity:54/171 - (31%)
Similarity:88/171 - (51%) Gaps:13/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KGTFVEKWVQYWNG--------LVRDYTEVAVGVVRESYTKPKKALLYGTGML-FMYQANLKNPG 83
            |||   :|.:..||        |:.||.|.....|..:..:|.||.:| .|:| .||.....||.
Zfish    22 KGT---RWERLRNGRAGVWFRSLLTDYKEACREAVVGARDRPLKASVY-LGVLGGMYACCYTNPD 82

  Fly    84 EEAFMTLLRGATNRMITVPVELQNPVSADYLLTLERAINQKKLRLLSLGICTILWVDLYDEDDCT 148
            :.:|.|.|...:||:..:...:::..|..::.||.:..|:.:||..||||.::.:...||.:...
Zfish    83 DSSFETSLLETSNRLALLSPWIRSGTSDGHIQTLVKLRNEGRLRYASLGIASLTYYADYDAESSL 147

  Fly   149 YPAICEYTNVGVFNFHERIIDVGFWNQYWRLKWKMRNYDVN 189
            |.|.|...:|.....|:|::||||..::|.|..||:::|:|
Zfish   148 YEARCSAISVPWSELHKRVLDVGFAGRWWVLDHKMKDFDIN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14270NP_570063.1 DUF2366 22..190 CDD:287180 54/171 (32%)
timm29NP_001018397.1 DUF2366 24..189 CDD:287180 52/169 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594932
Domainoid 1 1.000 82 1.000 Domainoid score I8326
eggNOG 1 0.900 - - E1_KOG4545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34702
Inparanoid 1 1.050 82 1.000 Inparanoid score I5175
OMA 1 1.010 - - QHG49426
OrthoDB 1 1.010 - - D1386679at2759
OrthoFinder 1 1.000 - - FOG0007519
OrthoInspector 1 1.000 - - oto39031
orthoMCL 1 0.900 - - OOG6_108329
Panther 1 1.100 - - LDO PTHR21435
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5853
SonicParanoid 1 1.000 - - X6409
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.