DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14270 and timm29

DIOPT Version :9

Sequence 1:NP_570063.1 Gene:CG14270 / 31319 FlyBaseID:FBgn0029665 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001011059.1 Gene:timm29 / 496469 XenbaseID:XB-GENE-959666 Length:238 Species:Xenopus tropicalis


Alignment Length:182 Identity:50/182 - (27%)
Similarity:89/182 - (48%) Gaps:6/182 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TALRQRLTDRIQMP---ERFKGTFVEKWVQYWNGLVRDYTEVAVGVVRESYTKPKKALLYGTGML 72
            :|...:.|:.:..|   ||||...:..|.:   .|:.||.|....:...:..:|.||..|.:.:.
 Frog    17 SAASGQATEAVGKPGRWERFKSGKIAVWTK---SLLHDYAEACKDIAVGAKERPGKAAFYLSLLT 78

  Fly    73 FMYQANLKNPGEEAFMTLLRGATNRMITVPVELQNPVSADYLLTLERAINQKKLRLLSLGICTIL 137
            .....:.|.|||:.|.:.:..|:..::.:....::..|..::..|....||..||.|:|.:.:|:
 Frog    79 AAGVCSAKAPGEDHFHSCMLEASASLLLLSPWTRSRKSDQHVQNLMDLRNQGGLRHLNLFLFSIV 143

  Fly   138 WVDLYDEDDCTYPAICEYTNVGVFNFHERIIDVGFWNQYWRLKWKMRNYDVN 189
            :...||.|...|||.|.:.......|..|::|:||:.::|.|:.||.::|||
 Frog   144 YEAPYDPDCDLYPAQCPHLQPRWAQFPSRVLDIGFFGRWWLLRAKMEDFDVN 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14270NP_570063.1 DUF2366 22..190 CDD:287180 48/171 (28%)
timm29NP_001011059.1 DUF2366 31..196 CDD:313409 47/168 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 76 1.000 Domainoid score I8781
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34702
Inparanoid 1 1.050 76 1.000 Inparanoid score I5087
OMA 1 1.010 - - QHG49426
OrthoDB 1 1.010 - - D1386679at2759
OrthoFinder 1 1.000 - - FOG0007519
OrthoInspector 1 1.000 - - oto104368
Panther 1 1.100 - - LDO PTHR21435
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5853
SonicParanoid 1 1.000 - - X6409
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.