DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14270 and Timm29

DIOPT Version :9

Sequence 1:NP_570063.1 Gene:CG14270 / 31319 FlyBaseID:FBgn0029665 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001101599.1 Gene:Timm29 / 315463 RGDID:1309188 Length:267 Species:Rattus norvegicus


Alignment Length:159 Identity:46/159 - (28%)
Similarity:78/159 - (49%) Gaps:5/159 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WVQY--WN-GLVRDYTEVAVGVVRESYTKPKKALLYGTGMLFMYQANLK-NPGEEAFMTLLRGAT 95
            |.:.  |: .|:|||.|........:..:|.:|.|| .|:|....|... .|.|.||...|..|:
  Rat    35 WTRLGTWSRALLRDYAEACGDAAAAARARPGRAALY-VGLLGGAAACCALAPSEAAFEEALLDAS 98

  Fly    96 NRMITVPVELQNPVSADYLLTLERAINQKKLRLLSLGICTILWVDLYDEDDCTYPAICEYTNVGV 160
            :.::.:....:|..|.::|..|.....:.:||.::||.|::::...:|.....|.|.|.|.....
  Rat    99 SSLLLLAPATRNRHSEEFLQRLLWLRGRGRLRHVNLGFCSLVYEAPFDAQASLYQARCRYLQPRW 163

  Fly   161 FNFHERIIDVGFWNQYWRLKWKMRNYDVN 189
            .:|..|::||||..::|.||.:|.:.|:|
  Rat   164 VDFPGRVLDVGFVGRWWVLKNRMHDCDIN 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14270NP_570063.1 DUF2366 22..190 CDD:287180 46/159 (29%)
Timm29NP_001101599.1 DUF2366 31..193 CDD:287180 46/159 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352958
Domainoid 1 1.000 67 1.000 Domainoid score I9627
eggNOG 1 0.900 - - E1_KOG4545
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34702
Inparanoid 1 1.050 67 1.000 Inparanoid score I5253
OMA 1 1.010 - - QHG49426
OrthoDB 1 1.010 - - D1386679at2759
OrthoFinder 1 1.000 - - FOG0007519
OrthoInspector 1 1.000 - - oto97681
orthoMCL 1 0.900 - - OOG6_108329
Panther 1 1.100 - - LDO PTHR21435
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6409
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.