DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14270 and R04F11.5

DIOPT Version :9

Sequence 1:NP_570063.1 Gene:CG14270 / 31319 FlyBaseID:FBgn0029665 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_506089.1 Gene:R04F11.5 / 179689 WormBaseID:WBGene00011017 Length:185 Species:Caenorhabditis elegans


Alignment Length:168 Identity:41/168 - (24%)
Similarity:76/168 - (45%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KGTFVEKWV---QYWNGLVRDYTEVAVGVVRESYTKPKKALLYGTGMLFMYQANLKNPGEEAFMT 89
            ||.|....:   :|:..:..||..||...|:....:|.||.:..:|:.|:..|...||.|.....
 Worm     7 KGFFQRTGISIKEYFKRMGNDYATVARETVQGCKDRPVKAGVVFSGLGFLTYAYQTNPTELEMYD 71

  Fly    90 LLRGATNRMITVPVELQNPVSADYLLTLERAINQKKLRLLSLGICTILWVDLYDEDDCTYPAICE 154
            .|.....:::.||....||.:...|...:..|:|.:|...:|...::|....|::....|.:  :
 Worm    72 YLCERRQKLVLVPNSEHNPATTKELTARDFLISQNRLHYYNLWFFSLLVASDYNDKLRIYSS--Q 134

  Fly   155 YTNVGVFNFHE---RIIDVGFWNQYWRLKWKMRNYDVN 189
            .:|:..:.:.|   .|:|:|...::.|::....:||||
 Worm   135 DSNLKDWPWTELWRNIVDIGALGRWHRMETAFVDYDVN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14270NP_570063.1 DUF2366 22..190 CDD:287180 41/168 (24%)
R04F11.5NP_506089.1 DUF2366 8..172 CDD:287180 38/165 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166489
Domainoid 1 1.000 48 1.000 Domainoid score I8056
eggNOG 1 0.900 - - E1_KOG4545
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I4128
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49426
OrthoDB 1 1.010 - - D1386679at2759
OrthoFinder 1 1.000 - - FOG0007519
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108329
Panther 1 1.100 - - LDO PTHR21435
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5853
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.800

Return to query results.
Submit another query.