DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10802 and AT3G16565

DIOPT Version :9

Sequence 1:NP_570062.1 Gene:CG10802 / 31318 FlyBaseID:FBgn0029664 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001325974.1 Gene:AT3G16565 / 820906 AraportID:AT3G16565 Length:289 Species:Arabidopsis thaliana


Alignment Length:301 Identity:68/301 - (22%)
Similarity:111/301 - (36%) Gaps:83/301 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VFKCQEDS-FLKEFKTKIVSSEFATLDWTDPSGKVEKLKGFNVICEDTILFPEGGGQPCDYGTL- 64
            :|..|..| ||..||.:              .|::.      :|.|.|:..|:|||||.|.|.: 
plant    14 MFNLQSHSRFLSLFKAQ--------------DGRIA------LILESTVFHPQGGGQPSDTGLIV 58

  Fly    65 --GG---FPVKNVQRKGSTAVHF-------VESPTSFEQDAEVLLTLDYQRRLDHMQQHSGQHLI 117
              |.   |.|::|:.|....:|:       .||....|:..||.||:|..||     :.:...:|
plant    59 FSGSDLKFSVQDVRSKDGIVLHYGVFEGSNPESGIDSEKGKEVYLTVDESRR-----KLNSSFVI 118

  Fly   118 TALFDREFKYD-----------------TTSWSLGSTVSYI--QLSTPHL--------------- 148
            ......||:|.                 .|..|.|..:...  ::...||               
plant   119 CWWNSSEFRYRLLKIVLIVMHGMVGTKFQTLHSAGHLLDMCMQKVGLGHLEPGKGYHFPDGPFVE 183

  Fly   149 ----ISRESLDL----IERQANDLIREGREVTVLLVDPEVAQEFQDARAPRGLPKDHEGLARVVR 205
                :.:|...:    :|.:||:||.:|.:|...::..|.|........|..:.|.  ...|:::
plant   184 YKGSVPQEEFQVKQKELEAEANELISKGGKVYAAILPYEEASVLCGGSLPDYISKG--STPRIIK 246

  Fly   206 IEGIESNMCCGTHVTNLSQLQCIKLLYAEKVKANVLVHFVV 246
            :.......|.||||:|||.:..:|:......|....|.:.:
plant   247 LGDSPGCPCGGTHVSNLSDIISMKITQMRTKKGMTKVFYTI 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10802NP_570062.1 AlaX 6..250 CDD:225427 67/297 (23%)
tRNA_SAD 43..229 CDD:298782 57/240 (24%)
AT3G16565NP_001325974.1 PLN02961 32..287 CDD:178546 61/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D910848at2759
OrthoFinder 1 1.000 - - FOG0006113
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.