DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10802 and Ptges3l

DIOPT Version :9

Sequence 1:NP_570062.1 Gene:CG10802 / 31318 FlyBaseID:FBgn0029664 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_001344503.1 Gene:Ptges3l / 73635 MGIID:1916146 Length:149 Species:Mus musculus


Alignment Length:39 Identity:10/39 - (25%)
Similarity:12/39 - (30%) Gaps:23/39 - (58%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 DRPKY-----------------------FSLHRRDGIEV 330
            |||||                       ||....||:|:
Mouse    12 DRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNGDGVEL 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10802NP_570062.1 AlaX 6..250 CDD:225427
tRNA_SAD 43..229 CDD:298782
Ptges3lNP_001344503.1 p23 5..110 CDD:107218 10/39 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104566
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.