powered by:
Protein Alignment CG10802 and Ptges3l
DIOPT Version :9
Sequence 1: | NP_570062.1 |
Gene: | CG10802 / 31318 |
FlyBaseID: | FBgn0029664 |
Length: | 436 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001344503.1 |
Gene: | Ptges3l / 73635 |
MGIID: | 1916146 |
Length: | 149 |
Species: | Mus musculus |
Alignment Length: | 39 |
Identity: | 10/39 - (25%) |
Similarity: | 12/39 - (30%) |
Gaps: | 23/39 - (58%) |
- Green bases have known domain annotations that are detailed below.
Fly 315 DRPKY-----------------------FSLHRRDGIEV 330
||||| ||....||:|:
Mouse 12 DRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNGDGVEL 50
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10802 | NP_570062.1 |
AlaX |
6..250 |
CDD:225427 |
|
tRNA_SAD |
43..229 |
CDD:298782 |
|
Ptges3l | NP_001344503.1 |
p23 |
5..110 |
CDD:107218 |
10/39 (26%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_104566 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.