DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10802 and AlaRS-m

DIOPT Version :9

Sequence 1:NP_570062.1 Gene:CG10802 / 31318 FlyBaseID:FBgn0029664 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_523932.2 Gene:AlaRS-m / 38595 FlyBaseID:FBgn0028962 Length:1012 Species:Drosophila melanogaster


Alignment Length:404 Identity:94/404 - (23%)
Similarity:152/404 - (37%) Gaps:72/404 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKCQEDSF-LKEFKTKIVSSEFATLDWTDPSGKVEKLKG----------FNVICEDTILFPEGGG 56
            |..:.||: :...||::       |.......:|.:.:|          .:::...:..:.|.||
  Fly   528 FDKESDSYQIPPLKTRV-------LGMLLNDAEVSRTQGSRIQQPFTDLISIVTAGSNFYYESGG 585

  Fly    57 QPCDYGTL-----------GGFPVKNVQRKGSTAVHF--VESPTSFEQDA---EVLLTLDYQRRL 105
            |..|.|.:           ....|..|:......||.  :.|||...|.|   ||.|.:|.|:|.
  Fly   586 QQSDGGKILVSNHQQPDHPHSLDVIGVKHLNDCVVHICKLSSPTDAFQLAIGDEVELQVDAQQRQ 650

  Fly   106 DHMQQHSGQHLITALFDREFKYDTTSWSLGSTVSYIQLSTP-----HLISRESLDLIERQANDLI 165
            .:...|:..||:.|.....||  ..::.:.|:||..|....     ..|.:..:.|||...|.:|
  Fly   651 LNTCHHTATHLLNAAIRSLFK--KVTYQVSSSVSSDQCKLELGLLGKRIQKTDVQLIEDLINRVI 713

  Fly   166 REGREVTVLLVDPEVAQEFQDARAPRGLPKDHEGLARVVRIEGIE-----SNMCCGTHVTNLSQL 225
            .....|.|.|:......|..|.....|.....:|| |:|.:|..|     ..:|||||.||.|:|
  Fly   714 CSAAPVEVQLLSAAEVLEQNDITMVPGEVYPEQGL-RLVNVESPELQLSSKELCCGTHATNTSEL 777

  Fly   226 QCIKLLYAEKV-KANVLVHFVVG---ERVLVKLGEVFQR----EQQL-TQALKGGPGQHLELVQ- 280
            .|..::..::. :|......|.|   |.||.....:..|    |:|. |..|.......|:.:: 
  Fly   778 SCFCIVNLKQTNRARFAFTAVAGQAAENVLKTAALLRHRVDLLEKQFQTDKLTNATEAELQTIRH 842

  Fly   281 -KLQQNVKGSRKYFQQLLKRYATAEAERLCDLPKKDRPKYFSLHRRDGIEVDFINTFLRAAP--- 341
             .|..::|....:....|:| .|...:|:.|..:....::..:..|         |.|:..|   
  Fly   843 NMLHTDIKLPYAFKMDTLER-ITEMLKRIKDSSRTTLKEFVDVEMR---------TLLQEKPLDT 897

  Fly   342 -EGIFYFLTVSESV 354
             ..|.:::|.|..|
  Fly   898 HPFILHYITSSALV 911

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10802NP_570062.1 AlaX 6..250 CDD:225427 70/284 (25%)
tRNA_SAD 43..229 CDD:298782 59/211 (28%)
AlaRS-mNP_523932.2 PLN02900 13..1010 CDD:215487 94/404 (23%)
AlaRS_core 14..261 CDD:238360
tRNA_SAD 570..>667 CDD:298782 25/96 (26%)
tRNA_SAD 748..>784 CDD:197931 15/36 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.